BLASTX nr result
ID: Mentha25_contig00030209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00030209 (741 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531249.1| hypothetical protein RCOM_0494170 [Ricinus c... 57 9e-06 >ref|XP_002531249.1| hypothetical protein RCOM_0494170 [Ricinus communis] gi|223529168|gb|EEF31146.1| hypothetical protein RCOM_0494170 [Ricinus communis] Length = 329 Score = 56.6 bits (135), Expect = 9e-06 Identities = 33/106 (31%), Positives = 55/106 (51%), Gaps = 11/106 (10%) Frame = +1 Query: 301 GIMI*NSMGNFVAPMVLTIPGRLRVEEGEVLGIHEARSWLKQL-----------RLIVDA 447 G++I +S G+FV + PG V+ E +G+ EA W+ L +++VDA Sbjct: 194 GMVIRDSAGSFVMGADGSSPGLFNVKLAEAIGLREAVQWVLSLGRSNVIFEYDAKVVVDA 253 Query: 448 VNGNNSDYTEFHSISSAFKQLLAHNVGFKILHVRHELNSIAHSLAR 585 V +D EF ++ + + LL H + + +R + N +AHSLAR Sbjct: 254 VLSGAADLFEFGAVIADCRLLLQHGCNYSVQFIRKQANLVAHSLAR 299