BLASTX nr result
ID: Mentha25_contig00030116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00030116 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004288359.1| PREDICTED: two-pore potassium channel 5-like... 73 4e-11 ref|XP_007051279.1| Ca2+ activated outward rectifying K+ channel... 72 6e-11 gb|EYU46878.1| hypothetical protein MIMGU_mgv1a007372mg [Mimulus... 72 1e-10 ref|XP_006355824.1| PREDICTED: two-pore potassium channel 5-like... 71 1e-10 ref|XP_004240644.1| PREDICTED: two-pore potassium channel 5-like... 71 1e-10 ref|XP_002320260.2| hypothetical protein POPTR_0014s10900g [Popu... 70 3e-10 ref|XP_002515189.1| Calcium-activated outward-rectifying potassi... 70 3e-10 ref|XP_002302805.1| calcium-activated outward-rectifying potassi... 70 4e-10 emb|CBI37064.3| unnamed protein product [Vitis vinifera] 69 5e-10 ref|XP_002274039.1| PREDICTED: probable calcium-activated outwar... 69 5e-10 emb|CAN67132.1| hypothetical protein VITISV_040173 [Vitis vinifera] 69 5e-10 ref|XP_007221537.1| hypothetical protein PRUPE_ppa023309mg [Prun... 69 7e-10 ref|XP_003520770.1| PREDICTED: two-pore potassium channel 5-like... 68 1e-09 gb|EXB44459.1| putative calcium-activated outward-rectifying pot... 67 3e-09 ref|XP_007163240.1| hypothetical protein PHAVU_001G217800g [Phas... 67 3e-09 ref|XP_006840342.1| hypothetical protein AMTR_s00045p00103250 [A... 67 3e-09 ref|XP_002317301.1| calcium-activated outward-rectifying potassi... 67 3e-09 ref|XP_003626060.1| Outward rectifying potassium channel [Medica... 66 6e-09 ref|XP_003554573.1| PREDICTED: two-pore potassium channel 5-like... 65 7e-09 ref|XP_006660519.1| PREDICTED: LOW QUALITY PROTEIN: two pore pot... 65 1e-08 >ref|XP_004288359.1| PREDICTED: two-pore potassium channel 5-like [Fragaria vesca subsp. vesca] Length = 397 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 SEY++YKLKEMGKI EKDI+QICDQFSKLDSN+SGKIT Sbjct: 351 SEYIVYKLKEMGKIDEKDIMQICDQFSKLDSNHSGKIT 388 >ref|XP_007051279.1| Ca2+ activated outward rectifying K+ channel 5 [Theobroma cacao] gi|508703540|gb|EOX95436.1| Ca2+ activated outward rectifying K+ channel 5 [Theobroma cacao] Length = 388 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 SEYVIYKLKEMGKI EKDILQIC+QFSKLD NNSGKIT Sbjct: 342 SEYVIYKLKEMGKIGEKDILQICNQFSKLDPNNSGKIT 379 >gb|EYU46878.1| hypothetical protein MIMGU_mgv1a007372mg [Mimulus guttatus] Length = 409 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 SEYVIYKLKEMGKIKE DILQIC+QF+KLD NNSGKIT Sbjct: 363 SEYVIYKLKEMGKIKETDILQICNQFNKLDPNNSGKIT 400 >ref|XP_006355824.1| PREDICTED: two-pore potassium channel 5-like [Solanum tuberosum] Length = 379 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 SEYVIYKLKEMGKI EKD++QIC+QF+KLD NNSGKIT Sbjct: 333 SEYVIYKLKEMGKISEKDVMQICNQFNKLDENNSGKIT 370 >ref|XP_004240644.1| PREDICTED: two-pore potassium channel 5-like [Solanum lycopersicum] Length = 379 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 SEYVIYKLKEMGKI EKD++QIC+QF+KLD NNSGKIT Sbjct: 333 SEYVIYKLKEMGKINEKDVMQICNQFNKLDENNSGKIT 370 >ref|XP_002320260.2| hypothetical protein POPTR_0014s10900g [Populus trichocarpa] gi|550323953|gb|EEE98575.2| hypothetical protein POPTR_0014s10900g [Populus trichocarpa] Length = 357 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 SEYVIYKLKEMGKI EKDILQIC+QFSKLD NN GKIT Sbjct: 311 SEYVIYKLKEMGKIGEKDILQICNQFSKLDPNNLGKIT 348 >ref|XP_002515189.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] gi|223545669|gb|EEF47173.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] Length = 390 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 SEYVIYKLKEMGKI EKDILQIC+QFSKLD NN GKIT Sbjct: 344 SEYVIYKLKEMGKIGEKDILQICNQFSKLDPNNLGKIT 381 >ref|XP_002302805.1| calcium-activated outward-rectifying potassium channel 5 family protein [Populus trichocarpa] gi|222844531|gb|EEE82078.1| calcium-activated outward-rectifying potassium channel 5 family protein [Populus trichocarpa] Length = 379 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 SEYVIYKLKEMGKI EKD+LQIC+QFSKLD NN GKIT Sbjct: 333 SEYVIYKLKEMGKIGEKDVLQICNQFSKLDPNNLGKIT 370 >emb|CBI37064.3| unnamed protein product [Vitis vinifera] Length = 215 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 SEYVIYKLKEMGKI E D+LQIC+QF+KLD NNSGKIT Sbjct: 169 SEYVIYKLKEMGKIAENDVLQICNQFNKLDPNNSGKIT 206 >ref|XP_002274039.1| PREDICTED: probable calcium-activated outward-rectifying potassium channel 5, chloroplastic [Vitis vinifera] Length = 390 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 SEYVIYKLKEMGKI E D+LQIC+QF+KLD NNSGKIT Sbjct: 344 SEYVIYKLKEMGKIAENDVLQICNQFNKLDPNNSGKIT 381 >emb|CAN67132.1| hypothetical protein VITISV_040173 [Vitis vinifera] Length = 390 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 SEYVIYKLKEMGKI E D+LQIC+QF+KLD NNSGKIT Sbjct: 344 SEYVIYKLKEMGKIAENDVLQICNQFNKLDPNNSGKIT 381 >ref|XP_007221537.1| hypothetical protein PRUPE_ppa023309mg [Prunus persica] gi|462418287|gb|EMJ22736.1| hypothetical protein PRUPE_ppa023309mg [Prunus persica] Length = 376 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 SEYVI+KLKEMGKI EKDILQIC+QFSKLD N+SGKIT Sbjct: 330 SEYVIHKLKEMGKIGEKDILQICNQFSKLDQNHSGKIT 367 >ref|XP_003520770.1| PREDICTED: two-pore potassium channel 5-like [Glycine max] Length = 376 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 SEYVI+KLKEMGKI+EKD+LQICDQF KLD +N GKIT Sbjct: 330 SEYVIFKLKEMGKIQEKDVLQICDQFRKLDPSNCGKIT 367 >gb|EXB44459.1| putative calcium-activated outward-rectifying potassium channel 5 [Morus notabilis] Length = 378 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 SEYVIYKLKEMG+I EKDIL+IC+QF +LD NNSGKIT Sbjct: 322 SEYVIYKLKEMGRIGEKDILEICNQFCRLDPNNSGKIT 359 >ref|XP_007163240.1| hypothetical protein PHAVU_001G217800g [Phaseolus vulgaris] gi|561036704|gb|ESW35234.1| hypothetical protein PHAVU_001G217800g [Phaseolus vulgaris] Length = 417 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 SEYVI+KLKEMGKI EKD+LQICDQF KLD +N GKIT Sbjct: 371 SEYVIFKLKEMGKIHEKDVLQICDQFRKLDPSNCGKIT 408 >ref|XP_006840342.1| hypothetical protein AMTR_s00045p00103250 [Amborella trichopoda] gi|548842060|gb|ERN02017.1| hypothetical protein AMTR_s00045p00103250 [Amborella trichopoda] Length = 399 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 +EYVIYKLKEMGK+ EKDILQIC+QF +LD+ NSGKIT Sbjct: 353 AEYVIYKLKEMGKVAEKDILQICNQFDRLDTENSGKIT 390 >ref|XP_002317301.1| calcium-activated outward-rectifying potassium channel 3 family protein [Populus trichocarpa] gi|222860366|gb|EEE97913.1| calcium-activated outward-rectifying potassium channel 3 family protein [Populus trichocarpa] Length = 428 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 SEYVIYKLKEMGKI EKDILQIC QF +LD+ N GKIT Sbjct: 382 SEYVIYKLKEMGKISEKDILQICQQFERLDTGNCGKIT 419 >ref|XP_003626060.1| Outward rectifying potassium channel [Medicago truncatula] gi|355501075|gb|AES82278.1| Outward rectifying potassium channel [Medicago truncatula] Length = 382 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 SEYVI+KLKEMGKI++KD++QICDQF KLD +N GKIT Sbjct: 336 SEYVIFKLKEMGKIQDKDVMQICDQFRKLDPSNCGKIT 373 >ref|XP_003554573.1| PREDICTED: two-pore potassium channel 5-like [Glycine max] Length = 385 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 SEYVI+ LKEMGKI+EKD+LQICDQF KLD +N GKIT Sbjct: 339 SEYVIFMLKEMGKIQEKDVLQICDQFRKLDPSNCGKIT 376 >ref|XP_006660519.1| PREDICTED: LOW QUALITY PROTEIN: two pore potassium channel c-like [Oryza brachyantha] Length = 452 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 343 SEYVIYKLKEMGKIKEKDILQICDQFSKLDSNNSGKIT 230 SE+VIYKLKEMGKI EKDI+ ICDQF +LD+ N GKIT Sbjct: 392 SEFVIYKLKEMGKISEKDIIMICDQFQRLDTGNCGKIT 429