BLASTX nr result
ID: Mentha25_contig00029633
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00029633 (469 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006387125.1| hypothetical protein POPTR_1770s002002g, par... 59 9e-07 ref|XP_006449047.1| hypothetical protein CICLE_v10016439mg [Citr... 56 6e-06 ref|XP_006396660.1| hypothetical protein EUTSA_v10028917mg [Eutr... 55 8e-06 >ref|XP_006387125.1| hypothetical protein POPTR_1770s002002g, partial [Populus trichocarpa] gi|550305114|gb|ERP46039.1| hypothetical protein POPTR_1770s002002g, partial [Populus trichocarpa] Length = 122 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 3 AAYLPWVLLGFSVLVGASAWVDLLVCY 83 AAYLPWVLLGFSVLVGASAWVDLLVC+ Sbjct: 94 AAYLPWVLLGFSVLVGASAWVDLLVCF 120 >ref|XP_006449047.1| hypothetical protein CICLE_v10016439mg [Citrus clementina] gi|557551658|gb|ESR62287.1| hypothetical protein CICLE_v10016439mg [Citrus clementina] Length = 187 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 3 AAYLPWVLLGFSVLVGASAWVDLLVC 80 AAYLPWVLLGFSV VGASAWVDLLVC Sbjct: 161 AAYLPWVLLGFSVFVGASAWVDLLVC 186 >ref|XP_006396660.1| hypothetical protein EUTSA_v10028917mg [Eutrema salsugineum] gi|557097677|gb|ESQ38113.1| hypothetical protein EUTSA_v10028917mg [Eutrema salsugineum] Length = 197 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +3 Query: 3 AAYLPWVLLGFSVLVGASAWVDLLVCYTLLQLIF 104 AAYLPWVLLGFS+LVGASAWVDLLV T L F Sbjct: 161 AAYLPWVLLGFSILVGASAWVDLLVTPTTFWLRF 194