BLASTX nr result
ID: Mentha25_contig00029515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00029515 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38031.1| hypothetical protein MIMGU_mgv1a010394mg [Mimulus... 70 3e-10 ref|XP_006364359.1| PREDICTED: uncharacterized protein LOC102599... 58 2e-06 gb|AFK49386.1| unknown [Medicago truncatula] 56 4e-06 gb|ACJ85037.1| unknown [Medicago truncatula] 56 4e-06 ref|XP_003604099.1| hypothetical protein MTR_3g118500 [Medicago ... 56 4e-06 ref|XP_007200445.1| hypothetical protein PRUPE_ppa008919mg [Prun... 56 6e-06 ref|XP_004231095.1| PREDICTED: uncharacterized protein LOC101256... 56 6e-06 >gb|EYU38031.1| hypothetical protein MIMGU_mgv1a010394mg [Mimulus guttatus] Length = 313 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 377 SRHAVELEKRSIKLSLEEAKEMQRVRFNDVLGRYGKNVCTP 255 SRHAVELE++SIKLSLEEAKEMQRV DVLG+YGK VCTP Sbjct: 261 SRHAVELERQSIKLSLEEAKEMQRVGLFDVLGKYGKKVCTP 301 >ref|XP_006364359.1| PREDICTED: uncharacterized protein LOC102599247 isoform X1 [Solanum tuberosum] gi|565397563|ref|XP_006364360.1| PREDICTED: uncharacterized protein LOC102599247 isoform X2 [Solanum tuberosum] Length = 287 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 377 SRHAVELEKRSIKLSLEEAKEMQRVRFNDVLGRYGKN 267 S HAVELEKRSI+L+LEEAKE QRVR D+LG+Y KN Sbjct: 245 SNHAVELEKRSIRLALEEAKEAQRVRVLDILGKYPKN 281 >gb|AFK49386.1| unknown [Medicago truncatula] Length = 81 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 377 SRHAVELEKRSIKLSLEEAKEMQRVRFNDVLGRYGKNVCTP 255 SRHAVELEKRSI+LSLEEAKE+QRV +VLG+ KN P Sbjct: 27 SRHAVELEKRSIQLSLEEAKELQRVAVLNVLGKSAKNFKAP 67 >gb|ACJ85037.1| unknown [Medicago truncatula] Length = 299 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 377 SRHAVELEKRSIKLSLEEAKEMQRVRFNDVLGRYGKNVCTP 255 SRHAVELEKRSI+LSLEEAKE+QRV +VLG+ KN P Sbjct: 245 SRHAVELEKRSIQLSLEEAKELQRVAVLNVLGKSAKNFKAP 285 >ref|XP_003604099.1| hypothetical protein MTR_3g118500 [Medicago truncatula] gi|355493147|gb|AES74350.1| hypothetical protein MTR_3g118500 [Medicago truncatula] Length = 280 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 377 SRHAVELEKRSIKLSLEEAKEMQRVRFNDVLGRYGKNVCTP 255 SRHAVELEKRSI+LSLEEAKE+QRV +VLG+ KN P Sbjct: 226 SRHAVELEKRSIQLSLEEAKELQRVAVLNVLGKSAKNFKAP 266 >ref|XP_007200445.1| hypothetical protein PRUPE_ppa008919mg [Prunus persica] gi|462395845|gb|EMJ01644.1| hypothetical protein PRUPE_ppa008919mg [Prunus persica] Length = 314 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 377 SRHAVELEKRSIKLSLEEAKEMQRVRFNDVLGRYGKNVCTP 255 SRHAVELEKRSI+LSLEEAKE+QRV F +VLG+ K P Sbjct: 265 SRHAVELEKRSIQLSLEEAKELQRVGFLNVLGKPAKQFKVP 305 >ref|XP_004231095.1| PREDICTED: uncharacterized protein LOC101256042 [Solanum lycopersicum] Length = 289 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -3 Query: 377 SRHAVELEKRSIKLSLEEAKEMQRVRFNDVLGRYGKN 267 S HAVELEKRSI+L+LEEAKE RVR D+LG+Y KN Sbjct: 247 SNHAVELEKRSIRLALEEAKEAHRVRVLDILGKYPKN 283