BLASTX nr result
ID: Mentha25_contig00028343
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00028343 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19750.1| hypothetical protein MIMGU_mgv1a013483mg [Mimulus... 57 3e-06 ref|XP_004976652.1| PREDICTED: uncharacterized protein LOC101756... 55 1e-05 ref|XP_002520074.1| protein with unknown function [Ricinus commu... 55 1e-05 >gb|EYU19750.1| hypothetical protein MIMGU_mgv1a013483mg [Mimulus guttatus] Length = 219 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/38 (68%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = -2 Query: 112 MGGAYGGE-EDDGSVKWPRWLRPLLQSSFFGQCKAHAA 2 MGG GG ED G KWP WL PLL++SFFGQCK HAA Sbjct: 1 MGGCGGGGGEDSGGCKWPPWLGPLLETSFFGQCKLHAA 38 >ref|XP_004976652.1| PREDICTED: uncharacterized protein LOC101756154 [Setaria italica] Length = 251 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/41 (60%), Positives = 30/41 (73%), Gaps = 2/41 (4%) Frame = -2 Query: 121 NQSMGGAYGGEEDDGSV--KWPRWLRPLLQSSFFGQCKAHA 5 N + GGA GG E DG+ +WP WL+PLL +SFFGQCK HA Sbjct: 13 NTTRGGAMGGGECDGAENQRWPPWLKPLLGTSFFGQCKLHA 53 >ref|XP_002520074.1| protein with unknown function [Ricinus communis] gi|223540838|gb|EEF42398.1| protein with unknown function [Ricinus communis] Length = 251 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 106 GAYGGEEDDGSVKWPRWLRPLLQSSFFGQCKAHA 5 G +GG++DD VKWP WLRPLLQ+SFF QCK HA Sbjct: 37 GGHGGDKDD--VKWPPWLRPLLQTSFFVQCKLHA 68