BLASTX nr result
ID: Mentha25_contig00026801
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00026801 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19809.1| hypothetical protein MIMGU_mgv1a005320mg [Mimulus... 139 5e-31 ref|XP_002266822.1| PREDICTED: pentatricopeptide repeat-containi... 127 1e-27 emb|CAN67401.1| hypothetical protein VITISV_025967 [Vitis vinifera] 127 1e-27 ref|XP_007030407.1| Pentatricopeptide repeat (PPR-like) superfam... 125 8e-27 ref|XP_002884468.1| pentatricopeptide repeat-containing protein ... 123 3e-26 ref|XP_004142590.1| PREDICTED: pentatricopeptide repeat-containi... 122 7e-26 dbj|BAD95034.1| hypothetical protein [Arabidopsis thaliana] 122 7e-26 ref|NP_566237.1| pentatricopeptide repeat-containing protein [Ar... 122 7e-26 ref|XP_002521980.1| pentatricopeptide repeat-containing protein,... 120 2e-25 ref|XP_006296608.1| hypothetical protein CARUB_v10013258mg [Caps... 120 3e-25 ref|XP_007205118.1| hypothetical protein PRUPE_ppa004835mg [Prun... 120 3e-25 ref|XP_006371094.1| hypothetical protein POPTR_0019s03630g [Popu... 119 6e-25 ref|XP_006442665.1| hypothetical protein CICLE_v10019446mg [Citr... 117 2e-24 ref|XP_006487702.1| PREDICTED: pentatricopeptide repeat-containi... 115 5e-24 ref|XP_004236781.1| PREDICTED: pentatricopeptide repeat-containi... 115 6e-24 gb|EPS74045.1| hypothetical protein M569_00706, partial [Genlise... 113 2e-23 gb|EXB93167.1| hypothetical protein L484_024505 [Morus notabilis] 113 3e-23 ref|XP_004304772.1| PREDICTED: pentatricopeptide repeat-containi... 113 3e-23 ref|XP_006361415.1| PREDICTED: pentatricopeptide repeat-containi... 110 2e-22 ref|XP_006589209.1| PREDICTED: pentatricopeptide repeat-containi... 108 8e-22 >gb|EYU19809.1| hypothetical protein MIMGU_mgv1a005320mg [Mimulus guttatus] Length = 489 Score = 139 bits (349), Expect = 5e-31 Identities = 66/97 (68%), Positives = 78/97 (80%) Frame = +3 Query: 15 FIPSVVTYNIVILGLCKVHRIDDAITILVEMARKGCPPNETSYVLLIEGVGFAGWRTEAM 194 F+P+VVTYNIV+LGLCK HRI DA+ +L EM KGC PNETSYVLL+EG+GFAGWR EAM Sbjct: 390 FLPTVVTYNIVLLGLCKAHRIGDAVLMLEEMVEKGCQPNETSYVLLVEGIGFAGWRVEAM 449 Query: 195 ELANSLHRMNVISSQALRRLYRTFPVNGAYPGSVRTE 305 ELAN+L VIS+Q+LRRL RTFP+ Y V+TE Sbjct: 450 ELANTLCEKGVISNQSLRRLDRTFPIVDVYGSFVQTE 486 >ref|XP_002266822.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Vitis vinifera] Length = 582 Score = 127 bits (320), Expect = 1e-27 Identities = 60/94 (63%), Positives = 74/94 (78%) Frame = +3 Query: 3 KNSEFIPSVVTYNIVILGLCKVHRIDDAITILVEMARKGCPPNETSYVLLIEGVGFAGWR 182 + S F P+V++YNIV+LGLCKV RIDDAI + EM KGC PNET+Y+LLIEG+GFAGWR Sbjct: 479 EQSGFRPTVISYNIVLLGLCKVRRIDDAIGMFAEMIEKGCRPNETTYILLIEGIGFAGWR 538 Query: 183 TEAMELANSLHRMNVISSQALRRLYRTFPVNGAY 284 TEAMELANSL +VIS + +RL +TFP+ Y Sbjct: 539 TEAMELANSLFSRDVISQDSFKRLNKTFPMLDVY 572 >emb|CAN67401.1| hypothetical protein VITISV_025967 [Vitis vinifera] Length = 592 Score = 127 bits (320), Expect = 1e-27 Identities = 60/94 (63%), Positives = 74/94 (78%) Frame = +3 Query: 3 KNSEFIPSVVTYNIVILGLCKVHRIDDAITILVEMARKGCPPNETSYVLLIEGVGFAGWR 182 + S F P+V++YNIV+LGLCKV RIDDAI + EM KGC PNET+Y+LLIEG+GFAGWR Sbjct: 489 EQSGFRPTVISYNIVLLGLCKVRRIDDAIGMFAEMIEKGCRPNETTYILLIEGIGFAGWR 548 Query: 183 TEAMELANSLHRMNVISSQALRRLYRTFPVNGAY 284 TEAMELANSL +VIS + +RL +TFP+ Y Sbjct: 549 TEAMELANSLFSRDVISQDSFKRLNKTFPMLDVY 582 >ref|XP_007030407.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma cacao] gi|508719012|gb|EOY10909.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma cacao] Length = 586 Score = 125 bits (313), Expect = 8e-27 Identities = 57/88 (64%), Positives = 71/88 (80%) Frame = +3 Query: 21 PSVVTYNIVILGLCKVHRIDDAITILVEMARKGCPPNETSYVLLIEGVGFAGWRTEAMEL 200 P+V++YNIV+LGLCKVHRI+DAI +L M K C PNET+Y+LLIEG+GFAGWR+EAMEL Sbjct: 489 PTVISYNIVLLGLCKVHRINDAIEVLAAMVDKRCQPNETTYILLIEGIGFAGWRSEAMEL 548 Query: 201 ANSLHRMNVISSQALRRLYRTFPVNGAY 284 AN+L RM IS + +RL RTFP+ Y Sbjct: 549 ANALFRMEAISKDSFKRLNRTFPLLDVY 576 >ref|XP_002884468.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330308|gb|EFH60727.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 598 Score = 123 bits (308), Expect = 3e-26 Identities = 59/100 (59%), Positives = 74/100 (74%) Frame = +3 Query: 3 KNSEFIPSVVTYNIVILGLCKVHRIDDAITILVEMARKGCPPNETSYVLLIEGVGFAGWR 182 ++ EF PSVVTYNIV+LG CK HRI+DAI +L M GC PNET+Y +LIEG+GFAG+R Sbjct: 496 RSCEFHPSVVTYNIVLLGFCKAHRIEDAIDVLDSMVGNGCRPNETTYTVLIEGIGFAGYR 555 Query: 183 TEAMELANSLHRMNVISSQALRRLYRTFPVNGAYPGSVRT 302 EAMELAN L R+N IS + +RL+RTFP+ S +T Sbjct: 556 AEAMELANDLVRINAISEYSFKRLHRTFPLLNVLQRSSQT 595 >ref|XP_004142590.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Cucumis sativus] Length = 581 Score = 122 bits (305), Expect = 7e-26 Identities = 54/94 (57%), Positives = 73/94 (77%) Frame = +3 Query: 9 SEFIPSVVTYNIVILGLCKVHRIDDAITILVEMARKGCPPNETSYVLLIEGVGFAGWRTE 188 + F P+V+++NIV+LG+CK HR+ + I +L+ M KGC PNETSYVLLIEG+ +AGWR E Sbjct: 475 TRFQPTVISFNIVLLGMCKAHRVFEGIELLITMVEKGCLPNETSYVLLIEGIAYAGWRAE 534 Query: 189 AMELANSLHRMNVISSQALRRLYRTFPVNGAYPG 290 AMELANSL+R+ VIS + +RL +TFP+ Y G Sbjct: 535 AMELANSLYRLGVISGDSSKRLNKTFPMLDVYKG 568 >dbj|BAD95034.1| hypothetical protein [Arabidopsis thaliana] Length = 602 Score = 122 bits (305), Expect = 7e-26 Identities = 58/100 (58%), Positives = 74/100 (74%) Frame = +3 Query: 3 KNSEFIPSVVTYNIVILGLCKVHRIDDAITILVEMARKGCPPNETSYVLLIEGVGFAGWR 182 ++ EF PSVVTYNIV+LG CK HRI+DAI +L M GC PNET+Y +LIEG+GFAG+R Sbjct: 500 RSCEFHPSVVTYNIVLLGFCKAHRIEDAINVLESMVGNGCRPNETTYTVLIEGIGFAGYR 559 Query: 183 TEAMELANSLHRMNVISSQALRRLYRTFPVNGAYPGSVRT 302 EAMELAN L R++ IS + +RL+RTFP+ S +T Sbjct: 560 AEAMELANDLVRIDAISEYSFKRLHRTFPLLNVLQRSSQT 599 >ref|NP_566237.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75207286|sp|Q9SR00.1|PP213_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g04760, chloroplastic; Flags: Precursor gi|6175176|gb|AAF04902.1|AC011437_17 hypothetical protein [Arabidopsis thaliana] gi|15810359|gb|AAL07067.1| unknown protein [Arabidopsis thaliana] gi|22136960|gb|AAM91709.1| unknown protein [Arabidopsis thaliana] gi|332640611|gb|AEE74132.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 602 Score = 122 bits (305), Expect = 7e-26 Identities = 58/100 (58%), Positives = 74/100 (74%) Frame = +3 Query: 3 KNSEFIPSVVTYNIVILGLCKVHRIDDAITILVEMARKGCPPNETSYVLLIEGVGFAGWR 182 ++ EF PSVVTYNIV+LG CK HRI+DAI +L M GC PNET+Y +LIEG+GFAG+R Sbjct: 500 RSCEFHPSVVTYNIVLLGFCKAHRIEDAINVLESMVGNGCRPNETTYTVLIEGIGFAGYR 559 Query: 183 TEAMELANSLHRMNVISSQALRRLYRTFPVNGAYPGSVRT 302 EAMELAN L R++ IS + +RL+RTFP+ S +T Sbjct: 560 AEAMELANDLVRIDAISEYSFKRLHRTFPLLNVLQRSSQT 599 >ref|XP_002521980.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538784|gb|EEF40384.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 584 Score = 120 bits (302), Expect = 2e-25 Identities = 55/94 (58%), Positives = 72/94 (76%) Frame = +3 Query: 3 KNSEFIPSVVTYNIVILGLCKVHRIDDAITILVEMARKGCPPNETSYVLLIEGVGFAGWR 182 ++ + P+VV+YNI++LGLCKV+R +DAI +L M KGC PNET+Y+LLIEG+GF+G R Sbjct: 480 QSGRYRPNVVSYNIILLGLCKVNRANDAIEVLAAMTEKGCQPNETTYILLIEGIGFSGLR 539 Query: 183 TEAMELANSLHRMNVISSQALRRLYRTFPVNGAY 284 EAMELANSLH MN IS + RL +TFP+ Y Sbjct: 540 AEAMELANSLHGMNAISEDSFNRLNKTFPLLDVY 573 >ref|XP_006296608.1| hypothetical protein CARUB_v10013258mg [Capsella rubella] gi|482565317|gb|EOA29506.1| hypothetical protein CARUB_v10013258mg [Capsella rubella] Length = 607 Score = 120 bits (300), Expect = 3e-25 Identities = 55/90 (61%), Positives = 71/90 (78%) Frame = +3 Query: 3 KNSEFIPSVVTYNIVILGLCKVHRIDDAITILVEMARKGCPPNETSYVLLIEGVGFAGWR 182 ++ EF PSVVTYNIV+LG CK HRI+DAI +L M GC PNE++Y +LIEG+GFAG+R Sbjct: 504 RSCEFHPSVVTYNIVLLGFCKAHRIEDAIDVLESMVGNGCRPNESTYTVLIEGIGFAGYR 563 Query: 183 TEAMELANSLHRMNVISSQALRRLYRTFPV 272 EAMELAN L R++ IS + +RL+RTFP+ Sbjct: 564 AEAMELANDLVRIDAISEHSFKRLHRTFPL 593 >ref|XP_007205118.1| hypothetical protein PRUPE_ppa004835mg [Prunus persica] gi|462400760|gb|EMJ06317.1| hypothetical protein PRUPE_ppa004835mg [Prunus persica] Length = 489 Score = 120 bits (300), Expect = 3e-25 Identities = 53/86 (61%), Positives = 68/86 (79%) Frame = +3 Query: 15 FIPSVVTYNIVILGLCKVHRIDDAITILVEMARKGCPPNETSYVLLIEGVGFAGWRTEAM 194 F P+V++YNI++LGLCK R+ DAI +L EM KGC PNET+Y+LLIEG+GFAGWR EAM Sbjct: 390 FQPTVISYNIILLGLCKTRRVVDAIQVLTEMVEKGCRPNETTYILLIEGIGFAGWRAEAM 449 Query: 195 ELANSLHRMNVISSQALRRLYRTFPV 272 ELANS+ + IS + +RL RTFP+ Sbjct: 450 ELANSVFSLRAISEDSFKRLNRTFPM 475 >ref|XP_006371094.1| hypothetical protein POPTR_0019s03630g [Populus trichocarpa] gi|550316702|gb|ERP48891.1| hypothetical protein POPTR_0019s03630g [Populus trichocarpa] Length = 586 Score = 119 bits (297), Expect = 6e-25 Identities = 55/93 (59%), Positives = 70/93 (75%) Frame = +3 Query: 6 NSEFIPSVVTYNIVILGLCKVHRIDDAITILVEMARKGCPPNETSYVLLIEGVGFAGWRT 185 + F P++V+YNIV+LGLCKVHRIDDAI +L M GC PNET+Y LLIEG+GF+G R Sbjct: 486 SGRFQPNIVSYNIVLLGLCKVHRIDDAIEVLTAMIENGCQPNETTYTLLIEGIGFSGSRA 545 Query: 186 EAMELANSLHRMNVISSQALRRLYRTFPVNGAY 284 +AMELANSL+ MN IS + +RL + FP+ Y Sbjct: 546 QAMELANSLYSMNAISEGSYKRLNKVFPLLDVY 578 >ref|XP_006442665.1| hypothetical protein CICLE_v10019446mg [Citrus clementina] gi|557544927|gb|ESR55905.1| hypothetical protein CICLE_v10019446mg [Citrus clementina] Length = 583 Score = 117 bits (293), Expect = 2e-24 Identities = 54/94 (57%), Positives = 70/94 (74%) Frame = +3 Query: 3 KNSEFIPSVVTYNIVILGLCKVHRIDDAITILVEMARKGCPPNETSYVLLIEGVGFAGWR 182 +++ F P+VV+YNI+ILG CK RI++AI +L M KGC PNET+YVLLIEG+G+ GWR Sbjct: 480 ESTRFRPTVVSYNIIILGFCKTRRINEAIEVLAAMFEKGCKPNETTYVLLIEGIGYGGWR 539 Query: 183 TEAMELANSLHRMNVISSQALRRLYRTFPVNGAY 284 EAMELAN+L M+ IS +RL RTFP+ Y Sbjct: 540 AEAMELANALVSMHAISRDTFKRLNRTFPLLDVY 573 >ref|XP_006487702.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Citrus sinensis] Length = 583 Score = 115 bits (289), Expect = 5e-24 Identities = 52/94 (55%), Positives = 70/94 (74%) Frame = +3 Query: 3 KNSEFIPSVVTYNIVILGLCKVHRIDDAITILVEMARKGCPPNETSYVLLIEGVGFAGWR 182 +++ F P+V++YNI+ILG CK RI+++I +L M KGC PNET+YVLLIEG+G+ GWR Sbjct: 480 ESTRFRPTVISYNIIILGFCKTRRINESIEVLAAMFEKGCKPNETTYVLLIEGIGYGGWR 539 Query: 183 TEAMELANSLHRMNVISSQALRRLYRTFPVNGAY 284 EAMELAN+L M+ IS +RL RTFP+ Y Sbjct: 540 AEAMELANALVSMHAISRDTFKRLNRTFPLLDVY 573 >ref|XP_004236781.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Solanum lycopersicum] Length = 575 Score = 115 bits (288), Expect = 6e-24 Identities = 51/96 (53%), Positives = 72/96 (75%) Frame = +3 Query: 15 FIPSVVTYNIVILGLCKVHRIDDAITILVEMARKGCPPNETSYVLLIEGVGFAGWRTEAM 194 F P+V+TYNI++LGLCK HR+ +AI +L EM KGC PNET+Y+LLIEG+GF+G R +AM Sbjct: 474 FPPTVITYNILLLGLCKAHRVVEAIEVLAEMVEKGCRPNETTYILLIEGIGFSGRRVQAM 533 Query: 195 ELANSLHRMNVISSQALRRLYRTFPVNGAYPGSVRT 302 E+A +++ N IS ++L+RL +TF V Y + T Sbjct: 534 EMATAIYHKNAISKESLQRLRKTFQVPDVYSKDITT 569 >gb|EPS74045.1| hypothetical protein M569_00706, partial [Genlisea aurea] Length = 515 Score = 113 bits (283), Expect = 2e-23 Identities = 53/86 (61%), Positives = 69/86 (80%), Gaps = 2/86 (2%) Frame = +3 Query: 21 PSVVTYNIVILGLCKVHRIDDAITILVEMARKG--CPPNETSYVLLIEGVGFAGWRTEAM 194 PSVVTYN V+LGLCK HR+D+A+ +L EM G C PNETS+VLLIEG+GF+GW EAM Sbjct: 427 PSVVTYNAVLLGLCKAHRMDEAVEVLAEMVEGGGDCEPNETSFVLLIEGIGFSGWPVEAM 486 Query: 195 ELANSLHRMNVISSQALRRLYRTFPV 272 E+A+ LH+ +VIS+ +L+RL TFP+ Sbjct: 487 EIASCLHQRDVISTSSLKRLTVTFPL 512 >gb|EXB93167.1| hypothetical protein L484_024505 [Morus notabilis] Length = 587 Score = 113 bits (282), Expect = 3e-23 Identities = 53/87 (60%), Positives = 64/87 (73%) Frame = +3 Query: 24 SVVTYNIVILGLCKVHRIDDAITILVEMARKGCPPNETSYVLLIEGVGFAGWRTEAMELA 203 SV++YNIV+LGLCK RIDDAI +L M KGC PNET+Y LLIEG+GFAGWR EAM LA Sbjct: 491 SVISYNIVLLGLCKARRIDDAIELLAAMVEKGCRPNETTYTLLIEGIGFAGWRVEAMGLA 550 Query: 204 NSLHRMNVISSQALRRLYRTFPVNGAY 284 N L + IS + +RL +TFP+ Y Sbjct: 551 NLLFDIEAISEHSFKRLNKTFPMLDVY 577 >ref|XP_004304772.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 586 Score = 113 bits (282), Expect = 3e-23 Identities = 52/90 (57%), Positives = 66/90 (73%) Frame = +3 Query: 15 FIPSVVTYNIVILGLCKVHRIDDAITILVEMARKGCPPNETSYVLLIEGVGFAGWRTEAM 194 F P+V+TYNIV+LGL K RI DAI + M KGC PNET+Y+LLIEG+GFAGWR EAM Sbjct: 487 FQPTVITYNIVLLGLSKARRIVDAIEVFTAMVEKGCRPNETTYILLIEGIGFAGWRAEAM 546 Query: 195 ELANSLHRMNVISSQALRRLYRTFPVNGAY 284 ELA S++ ++ I + +RL RTFP+ Y Sbjct: 547 ELAKSVYSLSAICEDSFKRLSRTFPMLDVY 576 >ref|XP_006361415.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Solanum tuberosum] Length = 583 Score = 110 bits (276), Expect = 2e-22 Identities = 50/96 (52%), Positives = 72/96 (75%) Frame = +3 Query: 15 FIPSVVTYNIVILGLCKVHRIDDAITILVEMARKGCPPNETSYVLLIEGVGFAGWRTEAM 194 F P+V+TYNI++LGLCK HR+ +AI +L EM KG PNET+Y+LLIEG+GF+G R +AM Sbjct: 479 FPPTVITYNILLLGLCKAHRVVEAIEVLAEMVEKGRRPNETTYILLIEGIGFSGRRVQAM 538 Query: 195 ELANSLHRMNVISSQALRRLYRTFPVNGAYPGSVRT 302 E+A++++ N IS ++L+RL +TF V Y + T Sbjct: 539 EMASAIYHKNAISKESLQRLRKTFQVPDVYNKDITT 574 >ref|XP_006589209.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Glycine max] Length = 561 Score = 108 bits (270), Expect = 8e-22 Identities = 51/86 (59%), Positives = 64/86 (74%) Frame = +3 Query: 3 KNSEFIPSVVTYNIVILGLCKVHRIDDAITILVEMARKGCPPNETSYVLLIEGVGFAGWR 182 + SE+ P+V++YNIV+LGLCK HRI DAI +L M GC PNET+Y LL+EGVG+AGWR Sbjct: 470 ERSEWQPTVISYNIVLLGLCKAHRIVDAIEVLAVMVDNGCQPNETTYTLLVEGVGYAGWR 529 Query: 183 TEAMELANSLHRMNVISSQALRRLYR 260 + A+ELA SL MN IS RRL + Sbjct: 530 SYAVELAKSLVSMNAISQDLFRRLQK 555