BLASTX nr result
ID: Mentha25_contig00026277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00026277 (694 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18683.1| hypothetical protein MIMGU_mgv1a025989mg [Mimulus... 78 3e-12 >gb|EYU18683.1| hypothetical protein MIMGU_mgv1a025989mg [Mimulus guttatus] Length = 254 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/65 (55%), Positives = 48/65 (73%), Gaps = 4/65 (6%) Frame = +3 Query: 3 NEDHDPVVIFGDSLFPN---SVAGWGDDDENFKVPTNSSS-GNHAPPFVENWGNSFDNSG 170 +++HDPV+IFGDSL PN S GWGD++ENFK+P NSSS N+ + +NWG+SFDN Sbjct: 125 DQEHDPVIIFGDSLLPNQAYSSTGWGDEEENFKLPANSSSANNNGAEWEQNWGDSFDNV- 183 Query: 171 ATVGW 185 +GW Sbjct: 184 VPIGW 188