BLASTX nr result
ID: Mentha25_contig00026223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00026223 (487 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA48338.1| TPA: hypothetical protein ZEAMMB73_076919 [Zea m... 56 5e-06 >tpg|DAA48338.1| TPA: hypothetical protein ZEAMMB73_076919 [Zea mays] Length = 430 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 1/50 (2%) Frame = +2 Query: 2 QHQSNNGM-GPTPVDVPPTEKLNSGKTCPVPRMPDGTKGFSMGRGKPLAI 148 QH +N G P+ PP+E K P PRMPDGTKGF+MGRGKPL+I Sbjct: 367 QHYGHNSRDGHHPIGTPPSEHPAVPKPPPGPRMPDGTKGFTMGRGKPLSI 416