BLASTX nr result
ID: Mentha25_contig00026046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00026046 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002887656.1| hypothetical protein ARALYDRAFT_339849 [Arab... 61 2e-07 ref|NP_177803.1| alpha-crystallin domain of heat shock protein-c... 57 3e-06 >ref|XP_002887656.1| hypothetical protein ARALYDRAFT_339849 [Arabidopsis lyrata subsp. lyrata] gi|297333497|gb|EFH63915.1| hypothetical protein ARALYDRAFT_339849 [Arabidopsis lyrata subsp. lyrata] Length = 249 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/83 (37%), Positives = 54/83 (65%), Gaps = 4/83 (4%) Frame = +1 Query: 160 EPKQHEKKDEETYEQDLDNRSEEEKVGPSAIDEAS-EAEPGKVEEDEERPQ---RFKMCM 327 EPK E+++E+ ++ EE+K+G ++E + + E K EE E++P+ R K + Sbjct: 165 EPKPEEEEEEQEEAEEPQREEEEDKIGEEVVEEETRDHEEKKEEEIEDKPRKKRRKKFRL 224 Query: 328 PLVAGSTLLLTFVVFVIQMIRSK 396 P AGSTLL++ +VF+IQ+I+S+ Sbjct: 225 PCFAGSTLLMSIIVFIIQLIQSR 247 >ref|NP_177803.1| alpha-crystallin domain of heat shock protein-containing protein [Arabidopsis thaliana] gi|6143905|gb|AAF04451.1|AC010718_20 putative heat shock protein; 50341-51150 [Arabidopsis thaliana] gi|332197766|gb|AEE35887.1| alpha-crystallin domain of heat shock protein-containing protein [Arabidopsis thaliana] Length = 244 Score = 56.6 bits (135), Expect = 3e-06 Identities = 33/85 (38%), Positives = 54/85 (63%), Gaps = 4/85 (4%) Frame = +1 Query: 160 EPKQHEKKDEETYEQDLDNRSEEEKVGPSAIDEASEAEPGKVEED-EERPQ---RFKMCM 327 E K+ K +EE E + R EEE+V ++E + GK EE+ E++P+ R K + Sbjct: 164 EIKEETKPEEENEEAEEPQREEEEEV----VEEGTRDHEGKKEEEIEDKPRKKRRKKFRL 219 Query: 328 PLVAGSTLLLTFVVFVIQMIRSKHQ 402 P AGSTLL++ +VF+IQ+I+S+++ Sbjct: 220 PCFAGSTLLMSIIVFIIQLIQSRNK 244