BLASTX nr result
ID: Mentha25_contig00025417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00025417 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38895.1| hypothetical protein MIMGU_mgv1a023022mg, partial... 62 1e-07 >gb|EYU38895.1| hypothetical protein MIMGU_mgv1a023022mg, partial [Mimulus guttatus] Length = 703 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/64 (51%), Positives = 43/64 (67%), Gaps = 3/64 (4%) Frame = -3 Query: 307 AEERRVQGEL---HAPSFGAAIYVSRFANNMIGNVRRSHEVSNNNKNNKLATLVPQKPVD 137 AE+R + G L +PS GAA+Y S+FA NM+ N+RR NN + KL TL+PQKP + Sbjct: 640 AEDRVMHGALLGVDSPSIGAAVYASKFATNMLANLRR-----NNIPSPKLPTLLPQKPAE 694 Query: 136 PDFS 125 PDFS Sbjct: 695 PDFS 698