BLASTX nr result
ID: Mentha25_contig00025001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00025001 (521 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46077.1| hypothetical protein MIMGU_mgv1a002955mg [Mimulus... 58 2e-06 >gb|EYU46077.1| hypothetical protein MIMGU_mgv1a002955mg [Mimulus guttatus] Length = 622 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/58 (51%), Positives = 40/58 (68%) Frame = -1 Query: 182 MAVVLMRLLSGSVAPSAFISILVWFLLTKPFGSFAQTDVSCLRAIRSQLEDPMGNLGS 9 MAV+L R++S S APS ++ L+ FLLT+P AQ+DV CLRAI+ L DP+ L S Sbjct: 1 MAVLLPRIVSNSKAPSFLVTALILFLLTEPLSQAAQSDVDCLRAIKDTL-DPLNKLAS 57