BLASTX nr result
ID: Mentha25_contig00024978
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00024978 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528294.1| PREDICTED: heat stress transcription factor ... 58 2e-06 ref|XP_007136692.1| hypothetical protein PHAVU_009G065800g [Phas... 57 2e-06 emb|CBI19505.3| unnamed protein product [Vitis vinifera] 56 6e-06 ref|XP_002510200.1| DNA binding protein, putative [Ricinus commu... 56 6e-06 ref|XP_002284836.1| PREDICTED: heat stress transcription factor ... 56 6e-06 >ref|XP_003528294.1| PREDICTED: heat stress transcription factor B-4 [Glycine max] gi|83853831|gb|ABC47863.1| Heat shock transcription factor (HSF) [Glycine max] Length = 363 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +3 Query: 3 SKKRLHSDYNSSTAISKSRLVLEKDDLGLNLMPPPPC 113 SKKR+H DY S+ +K+RLVLEKDDLGLNLMPP C Sbjct: 327 SKKRVHPDYGSNPETNKARLVLEKDDLGLNLMPPSTC 363 >ref|XP_007136692.1| hypothetical protein PHAVU_009G065800g [Phaseolus vulgaris] gi|561009779|gb|ESW08686.1| hypothetical protein PHAVU_009G065800g [Phaseolus vulgaris] Length = 364 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +3 Query: 3 SKKRLHSDYNSSTAISKSRLVLEKDDLGLNLMPPPPC 113 SKKR+H DY S++ +K+RLVL+KDDLGLNLMPP C Sbjct: 328 SKKRVHPDYGSNSETNKARLVLDKDDLGLNLMPPSTC 364 >emb|CBI19505.3| unnamed protein product [Vitis vinifera] Length = 281 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/40 (67%), Positives = 32/40 (80%), Gaps = 3/40 (7%) Frame = +3 Query: 3 SKKRLHSDYNSSTA---ISKSRLVLEKDDLGLNLMPPPPC 113 SKKRLH +Y S+T +K+RLVL+KDDLGLNLMPP PC Sbjct: 242 SKKRLHPEYASTTTSMETNKARLVLDKDDLGLNLMPPSPC 281 >ref|XP_002510200.1| DNA binding protein, putative [Ricinus communis] gi|223550901|gb|EEF52387.1| DNA binding protein, putative [Ricinus communis] Length = 362 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 4/41 (9%) Frame = +3 Query: 3 SKKRLHSDYNSSTA----ISKSRLVLEKDDLGLNLMPPPPC 113 SKKRLHS+YN+S SK+RL+LEKDDLGLNLMPP C Sbjct: 322 SKKRLHSEYNASHTGNMETSKARLMLEKDDLGLNLMPPSTC 362 >ref|XP_002284836.1| PREDICTED: heat stress transcription factor B-4 [Vitis vinifera] gi|147768919|emb|CAN66983.1| hypothetical protein VITISV_004457 [Vitis vinifera] Length = 363 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/40 (67%), Positives = 32/40 (80%), Gaps = 3/40 (7%) Frame = +3 Query: 3 SKKRLHSDYNSSTA---ISKSRLVLEKDDLGLNLMPPPPC 113 SKKRLH +Y S+T +K+RLVL+KDDLGLNLMPP PC Sbjct: 324 SKKRLHPEYASTTTSMETNKARLVLDKDDLGLNLMPPSPC 363