BLASTX nr result
ID: Mentha25_contig00024934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00024934 (668 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU75567.1| DUF1754 superfamily protein [Blumeria graminis f... 80 6e-13 gb|EPQ67054.1| hypothetical protein BGT96224_3504 [Blumeria gram... 80 6e-13 dbj|GAD95145.1| conserved hypothetical protein [Byssochlamys spe... 71 7e-11 gb|EZF30912.1| hypothetical protein H101_05458 [Trichophyton int... 73 7e-11 gb|EQL31804.1| hypothetical protein BDFG_05863 [Ajellomyces derm... 73 7e-11 gb|EGE00840.1| hypothetical protein TESG_08145 [Trichophyton ton... 73 7e-11 ref|XP_003239399.1| hypothetical protein TERG_01380 [Trichophyto... 73 7e-11 ref|XP_002847473.1| conserved hypothetical protein [Arthroderma ... 73 7e-11 ref|XP_007295560.1| hypothetical protein MBM_07671 [Marssonina b... 73 9e-11 ref|XP_002793559.1| hypothetical protein PAAG_04469 [Paracoccidi... 73 9e-11 gb|EEH22048.1| hypothetical protein PABG_04259 [Paracoccidioides... 73 9e-11 gb|ERF73891.1| hypothetical protein EPUS_05903 [Endocarpon pusil... 72 1e-10 ref|XP_001727539.2| hypothetical protein AOR_1_942194 [Aspergill... 70 2e-10 ref|XP_001392764.2| hypothetical protein ANI_1_2056074 [Aspergil... 70 2e-10 ref|XP_001539560.1| predicted protein [Ajellomyces capsulatus NA... 72 2e-10 ref|XP_001264418.1| hypothetical protein NFIA_012100 [Neosartory... 72 2e-10 ref|XP_001268914.1| conserved hypothetical protein [Aspergillus ... 72 2e-10 gb|ETI20137.1| hypothetical protein G647_08171 [Cladophialophora... 71 3e-10 gb|EMC99233.1| hypothetical protein BAUCODRAFT_395737 [Baudoinia... 71 3e-10 ref|XP_002837459.1| hypothetical protein [Tuber melanosporum Mel... 71 3e-10 >emb|CCU75567.1| DUF1754 superfamily protein [Blumeria graminis f. sp. hordei DH14] Length = 121 Score = 80.1 bits (196), Expect = 6e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 605 LIDRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 L DRL+KDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG Sbjct: 83 LHDRLTKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 121 >gb|EPQ67054.1| hypothetical protein BGT96224_3504 [Blumeria graminis f. sp. tritici 96224] Length = 121 Score = 80.1 bits (196), Expect = 6e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 605 LIDRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 L DRL+KDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG Sbjct: 83 LHDRLTKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 121 >dbj|GAD95145.1| conserved hypothetical protein [Byssochlamys spectabilis No. 5] Length = 130 Score = 71.2 bits (173), Expect(2) = 7e-11 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -1 Query: 605 LIDRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 L DRL ++G+KTHK+RVEELNKYLS LSEHHDMP+IGPG Sbjct: 92 LNDRLKREGVKTHKERVEELNKYLSTLSEHHDMPKIGPG 130 Score = 22.3 bits (46), Expect(2) = 7e-11 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -3 Query: 663 YEEMRKKRVRD 631 YEEMR+KR+ D Sbjct: 84 YEEMRRKRLND 94 >gb|EZF30912.1| hypothetical protein H101_05458 [Trichophyton interdigitale H6] Length = 138 Score = 73.2 bits (178), Expect = 7e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 605 LIDRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 L +RL ++G+KTHK+RVEELNKYLSNLSEHHDMPRIGPG Sbjct: 100 LNERLKREGVKTHKERVEELNKYLSNLSEHHDMPRIGPG 138 >gb|EQL31804.1| hypothetical protein BDFG_05863 [Ajellomyces dermatitidis ATCC 26199] Length = 162 Score = 73.2 bits (178), Expect = 7e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 605 LIDRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 L +RL ++G+KTHK+RVEELNKYLSNLSEHHDMPRIGPG Sbjct: 124 LDERLKREGVKTHKERVEELNKYLSNLSEHHDMPRIGPG 162 >gb|EGE00840.1| hypothetical protein TESG_08145 [Trichophyton tonsurans CBS 112818] gi|326485333|gb|EGE09343.1| hypothetical protein TEQG_08291 [Trichophyton equinum CBS 127.97] Length = 138 Score = 73.2 bits (178), Expect = 7e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 605 LIDRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 L +RL ++G+KTHK+RVEELNKYLSNLSEHHDMPRIGPG Sbjct: 100 LNERLKREGVKTHKERVEELNKYLSNLSEHHDMPRIGPG 138 >ref|XP_003239399.1| hypothetical protein TERG_01380 [Trichophyton rubrum CBS 118892] gi|326459655|gb|EGD85108.1| hypothetical protein TERG_01380 [Trichophyton rubrum CBS 118892] gi|607864299|gb|EZF09800.1| hypothetical protein H100_08852 [Trichophyton rubrum MR850] gi|607898839|gb|EZF36662.1| hypothetical protein H102_08813 [Trichophyton rubrum CBS 100081] gi|607911034|gb|EZF47352.1| hypothetical protein H103_08835 [Trichophyton rubrum CBS 288.86] gi|607923113|gb|EZF57992.1| hypothetical protein H104_08783 [Trichophyton rubrum CBS 289.86] gi|607935069|gb|EZF68640.1| hypothetical protein H105_08838 [Trichophyton soudanense CBS 452.61] gi|607946949|gb|EZF79210.1| hypothetical protein H110_08836 [Trichophyton rubrum MR1448] gi|607959121|gb|EZF89900.1| hypothetical protein H113_08903 [Trichophyton rubrum MR1459] gi|607971522|gb|EZG00895.1| hypothetical protein H106_08710 [Trichophyton rubrum CBS 735.88] gi|607983147|gb|EZG11512.1| hypothetical protein H107_08991 [Trichophyton rubrum CBS 202.88] Length = 139 Score = 73.2 bits (178), Expect = 7e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 605 LIDRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 L +RL ++G+KTHK+RVEELNKYLSNLSEHHDMPRIGPG Sbjct: 101 LNERLKREGVKTHKERVEELNKYLSNLSEHHDMPRIGPG 139 >ref|XP_002847473.1| conserved hypothetical protein [Arthroderma otae CBS 113480] gi|238840498|gb|EEQ30160.1| conserved hypothetical protein [Arthroderma otae CBS 113480] Length = 137 Score = 73.2 bits (178), Expect = 7e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 605 LIDRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 L +RL ++G+KTHK+RVEELNKYLSNLSEHHDMPRIGPG Sbjct: 99 LNERLKREGVKTHKERVEELNKYLSNLSEHHDMPRIGPG 137 >ref|XP_007295560.1| hypothetical protein MBM_07671 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406860938|gb|EKD13994.1| hypothetical protein MBM_07671 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 142 Score = 72.8 bits (177), Expect = 9e-11 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = -1 Query: 605 LIDRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 L++RL K+G+KTHK+RVEELN+YLS LSEHHDMPRIGPG Sbjct: 104 LLERLQKEGVKTHKERVEELNRYLSKLSEHHDMPRIGPG 142 >ref|XP_002793559.1| hypothetical protein PAAG_04469 [Paracoccidioides sp. 'lutzii' Pb01] gi|226277853|gb|EEH33419.1| hypothetical protein PAAG_04469 [Paracoccidioides sp. 'lutzii' Pb01] Length = 140 Score = 72.8 bits (177), Expect = 9e-11 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 605 LIDRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 L +RL ++G KTHK+RVEELNKYLSNLSEHHDMPRIGPG Sbjct: 102 LDERLKREGFKTHKERVEELNKYLSNLSEHHDMPRIGPG 140 >gb|EEH22048.1| hypothetical protein PABG_04259 [Paracoccidioides brasiliensis Pb03] gi|226293128|gb|EEH48548.1| hypothetical protein PADG_04627 [Paracoccidioides brasiliensis Pb18] Length = 140 Score = 72.8 bits (177), Expect = 9e-11 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 605 LIDRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 L +RL ++G KTHK+RVEELNKYLSNLSEHHDMPRIGPG Sbjct: 102 LDERLKREGFKTHKERVEELNKYLSNLSEHHDMPRIGPG 140 >gb|ERF73891.1| hypothetical protein EPUS_05903 [Endocarpon pusillum Z07020] Length = 143 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 605 LIDRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 L DRL ++G+KTHKQRVEELN+YLS LSEHHDMPRIGPG Sbjct: 105 LDDRLKREGVKTHKQRVEELNRYLSGLSEHHDMPRIGPG 143 >ref|XP_001727539.2| hypothetical protein AOR_1_942194 [Aspergillus oryzae RIB40] gi|391869675|gb|EIT78870.1| hypothetical protein Ao3042_04711 [Aspergillus oryzae 3.042] Length = 138 Score = 69.7 bits (169), Expect(2) = 2e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -1 Query: 605 LIDRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 L +RL ++G+KTHK+RVEELNKYLS LSEHHDMP+IGPG Sbjct: 100 LQERLKREGVKTHKERVEELNKYLSRLSEHHDMPKIGPG 138 Score = 22.3 bits (46), Expect(2) = 2e-10 Identities = 8/11 (72%), Positives = 11/11 (100%) Frame = -3 Query: 663 YEEMRKKRVRD 631 YEEMRKKR+++ Sbjct: 92 YEEMRKKRLQE 102 >ref|XP_001392764.2| hypothetical protein ANI_1_2056074 [Aspergillus niger CBS 513.88] Length = 137 Score = 69.7 bits (169), Expect(2) = 2e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -1 Query: 605 LIDRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 L +RL ++G+KTHK+RVEELNKYLS LSEHHDMP+IGPG Sbjct: 99 LQERLKREGVKTHKERVEELNKYLSRLSEHHDMPKIGPG 137 Score = 22.3 bits (46), Expect(2) = 2e-10 Identities = 8/11 (72%), Positives = 11/11 (100%) Frame = -3 Query: 663 YEEMRKKRVRD 631 YEEMRKKR+++ Sbjct: 91 YEEMRKKRLQE 101 >ref|XP_001539560.1| predicted protein [Ajellomyces capsulatus NAm1] gi|150413145|gb|EDN08528.1| predicted protein [Ajellomyces capsulatus NAm1] Length = 157 Score = 71.6 bits (174), Expect = 2e-10 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -1 Query: 605 LIDRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 L +RL ++G KTHK+RVEELN+YLSNLSEHHDMPRIGPG Sbjct: 119 LDERLKREGFKTHKERVEELNRYLSNLSEHHDMPRIGPG 157 >ref|XP_001264418.1| hypothetical protein NFIA_012100 [Neosartorya fischeri NRRL 181] gi|119412580|gb|EAW22521.1| hypothetical protein NFIA_012100 [Neosartorya fischeri NRRL 181] Length = 134 Score = 71.6 bits (174), Expect = 2e-10 Identities = 30/39 (76%), Positives = 37/39 (94%) Frame = -1 Query: 605 LIDRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 L++RL ++G+KTHK+RVEELNKYLS LSEHHDMP+IGPG Sbjct: 96 LLERLKREGVKTHKERVEELNKYLSRLSEHHDMPKIGPG 134 >ref|XP_001268914.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] gi|119397057|gb|EAW07488.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] Length = 132 Score = 71.6 bits (174), Expect = 2e-10 Identities = 30/39 (76%), Positives = 37/39 (94%) Frame = -1 Query: 605 LIDRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 L++RL ++G+KTHK+RVEELNKYLS LSEHHDMP+IGPG Sbjct: 94 LLERLKREGVKTHKERVEELNKYLSRLSEHHDMPKIGPG 132 >gb|ETI20137.1| hypothetical protein G647_08171 [Cladophialophora carrionii CBS 160.54] Length = 157 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = -1 Query: 605 LIDRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 L +RL ++G+KTHK+RVEELNKYLS+LSEHHDMPRIGPG Sbjct: 119 LEERLKREGVKTHKERVEELNKYLSSLSEHHDMPRIGPG 157 >gb|EMC99233.1| hypothetical protein BAUCODRAFT_395737 [Baudoinia compniacensis UAMH 10762] Length = 134 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -1 Query: 605 LIDRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 L +RL ++G+KTHK+RVEELNKYLS LSEHHDMPRIGPG Sbjct: 96 LDERLKREGIKTHKERVEELNKYLSGLSEHHDMPRIGPG 134 >ref|XP_002837459.1| hypothetical protein [Tuber melanosporum Mel28] gi|295633331|emb|CAZ81650.1| unnamed protein product [Tuber melanosporum] Length = 126 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 599 DRLSKDGLKTHKQRVEELNKYLSNLSEHHDMPRIGPG 489 +RL K+G+K+HK+RVEE NKYLSNLSEHHDMPRIGPG Sbjct: 90 ERLKKEGIKSHKERVEEFNKYLSNLSEHHDMPRIGPG 126