BLASTX nr result
ID: Mentha25_contig00024725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00024725 (372 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37749.1| hypothetical protein MIMGU_mgv1a003201mg [Mimulus... 71 2e-10 ref|XP_003631625.1| PREDICTED: probable E3 ubiquitin-protein lig... 60 4e-07 ref|XP_002284665.1| PREDICTED: probable E3 ubiquitin-protein lig... 60 4e-07 emb|CAN75679.1| hypothetical protein VITISV_033054 [Vitis vinifera] 60 4e-07 >gb|EYU37749.1| hypothetical protein MIMGU_mgv1a003201mg [Mimulus guttatus] Length = 600 Score = 70.9 bits (172), Expect = 2e-10 Identities = 39/74 (52%), Positives = 47/74 (63%), Gaps = 15/74 (20%) Frame = -3 Query: 370 RMYECIQNELLGSLQHTIQFIAPYQSKGIAKAGD--------------KC-PKAAGQPPG 236 + YEC++NELLGSL +T IAPY SKGI KAG+ KC KAA +PPG Sbjct: 492 KTYECVENELLGSLCYTTHHIAPYHSKGIEKAGELTVGWSAPLSDNNIKCRKKAADEPPG 551 Query: 235 DVMEMSQASTSGTS 194 DV+E QAS SG+S Sbjct: 552 DVIETGQASASGSS 565 >ref|XP_003631625.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI1 isoform 2 [Vitis vinifera] Length = 573 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/72 (44%), Positives = 40/72 (55%), Gaps = 13/72 (18%) Frame = -3 Query: 370 RMYECIQNELLGSLQHTIQFIAPYQSKGIAKA-------------GDKCPKAAGQPPGDV 230 +MYECI+N+LLGSLQH I IAPY+SKGI +A D CP + G Sbjct: 471 KMYECIENDLLGSLQHGIHNIAPYKSKGIERASELITCQSNKASNADNCPSSENGTDGGT 530 Query: 229 MEMSQASTSGTS 194 E + S SG+S Sbjct: 531 AEFDRPSGSGSS 542 >ref|XP_002284665.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI1 isoform 1 [Vitis vinifera] gi|297741410|emb|CBI32541.3| unnamed protein product [Vitis vinifera] Length = 589 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/72 (44%), Positives = 40/72 (55%), Gaps = 13/72 (18%) Frame = -3 Query: 370 RMYECIQNELLGSLQHTIQFIAPYQSKGIAKA-------------GDKCPKAAGQPPGDV 230 +MYECI+N+LLGSLQH I IAPY+SKGI +A D CP + G Sbjct: 487 KMYECIENDLLGSLQHGIHNIAPYKSKGIERASELITCQSNKASNADNCPSSENGTDGGT 546 Query: 229 MEMSQASTSGTS 194 E + S SG+S Sbjct: 547 AEFDRPSGSGSS 558 >emb|CAN75679.1| hypothetical protein VITISV_033054 [Vitis vinifera] Length = 788 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/72 (44%), Positives = 40/72 (55%), Gaps = 13/72 (18%) Frame = -3 Query: 370 RMYECIQNELLGSLQHTIQFIAPYQSKGIAKA-------------GDKCPKAAGQPPGDV 230 +MYECI+N+LLGSLQH I IAPY+SKGI +A D CP + G Sbjct: 686 KMYECIENDLLGSLQHGIHNIAPYKSKGIERASELITCQSNKASNADNCPSSENGTDGGT 745 Query: 229 MEMSQASTSGTS 194 E + S SG+S Sbjct: 746 AEFDRPSGSGSS 757