BLASTX nr result
ID: Mentha25_contig00024537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00024537 (362 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS65000.1| Ubiquitin-conjugating enzyme E2-17 kDa [Triticum ... 67 9e-11 gb|EMT27803.1| Ubiquitin-conjugating enzyme E2-17 kDa [Aegilops ... 67 9e-11 ref|XP_003626536.1| Ubiquitin carrier protein [Medicago truncatu... 67 9e-11 ref|XP_006401371.1| hypothetical protein EUTSA_v10014935mg [Eutr... 67 9e-11 gb|EMT16862.1| Ubiquitin-conjugating enzyme E2-17 kDa [Aegilops ... 67 9e-11 ref|XP_003564489.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 67 9e-11 gb|ACN39809.1| unknown [Picea sitchensis] 67 9e-11 ref|XP_002303624.1| ubiquitin conjugating-like enzyme family pro... 67 9e-11 ref|NP_001235332.1| uncharacterized protein LOC100305945 [Glycin... 67 9e-11 gb|AAY29571.1| immature spike ubiquitin-conjugating enzyme 2 [Tr... 67 9e-11 gb|EYU36894.1| hypothetical protein MIMGU_mgv1a015751mg [Mimulus... 67 9e-11 gb|AFY06649.1| ubiquitin conjugating enzyme, partial [Carica pap... 67 9e-11 ref|XP_006385788.1| hypothetical protein POPTR_0003s13600g [Popu... 67 9e-11 ref|XP_004252497.1| PREDICTED: uncharacterized protein LOC101254... 65 2e-10 gb|EXB72469.1| Ubiquitin-conjugating enzyme E2 10 [Morus notabilis] 65 2e-10 gb|EXC02953.1| Ubiquitin-conjugating enzyme E2 10 [Morus notabilis] 65 2e-10 ref|XP_004308017.1| PREDICTED: ubiquitin-conjugating enzyme E2 1... 65 2e-10 ref|XP_007218529.1| hypothetical protein PRUPE_ppa012628mg [Prun... 65 2e-10 ref|XP_003632627.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 65 2e-10 gb|EYU19615.1| hypothetical protein MIMGU_mgv1a015722mg [Mimulus... 65 2e-10 >gb|EMS65000.1| Ubiquitin-conjugating enzyme E2-17 kDa [Triticum urartu] Length = 217 Score = 66.6 bits (161), Expect(2) = 9e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 188 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 217 Score = 25.4 bits (54), Expect(2) = 9e-11 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 180 TDPNPDDPL 188 >gb|EMT27803.1| Ubiquitin-conjugating enzyme E2-17 kDa [Aegilops tauschii] Length = 162 Score = 66.6 bits (161), Expect(2) = 9e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 133 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 162 Score = 25.4 bits (54), Expect(2) = 9e-11 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 125 TDPNPDDPL 133 >ref|XP_003626536.1| Ubiquitin carrier protein [Medicago truncatula] gi|355501551|gb|AES82754.1| Ubiquitin carrier protein [Medicago truncatula] Length = 155 Score = 66.6 bits (161), Expect(2) = 9e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 126 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 155 Score = 25.4 bits (54), Expect(2) = 9e-11 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 118 TDPNPDDPL 126 >ref|XP_006401371.1| hypothetical protein EUTSA_v10014935mg [Eutrema salsugineum] gi|567178671|ref|XP_006401372.1| hypothetical protein EUTSA_v10014935mg [Eutrema salsugineum] gi|567178674|ref|XP_006401373.1| hypothetical protein EUTSA_v10014935mg [Eutrema salsugineum] gi|557102461|gb|ESQ42824.1| hypothetical protein EUTSA_v10014935mg [Eutrema salsugineum] gi|557102462|gb|ESQ42825.1| hypothetical protein EUTSA_v10014935mg [Eutrema salsugineum] gi|557102463|gb|ESQ42826.1| hypothetical protein EUTSA_v10014935mg [Eutrema salsugineum] Length = 148 Score = 66.6 bits (161), Expect(2) = 9e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 119 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 Score = 25.4 bits (54), Expect(2) = 9e-11 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 111 TDPNPDDPL 119 >gb|EMT16862.1| Ubiquitin-conjugating enzyme E2-17 kDa [Aegilops tauschii] Length = 148 Score = 66.6 bits (161), Expect(2) = 9e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 119 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 Score = 25.4 bits (54), Expect(2) = 9e-11 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 111 TDPNPDDPL 119 >ref|XP_003564489.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 1 [Brachypodium distachyon] gi|357125621|ref|XP_003564490.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 2 [Brachypodium distachyon] gi|357125623|ref|XP_003564491.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 3 [Brachypodium distachyon] gi|357133250|ref|XP_003568239.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 1 [Brachypodium distachyon] gi|357133252|ref|XP_003568240.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 2 [Brachypodium distachyon] gi|357133254|ref|XP_003568241.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 3 [Brachypodium distachyon] Length = 148 Score = 66.6 bits (161), Expect(2) = 9e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 119 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 Score = 25.4 bits (54), Expect(2) = 9e-11 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 111 TDPNPDDPL 119 >gb|ACN39809.1| unknown [Picea sitchensis] Length = 148 Score = 66.6 bits (161), Expect(2) = 9e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 119 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 Score = 25.4 bits (54), Expect(2) = 9e-11 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 111 TDPNPDDPL 119 >ref|XP_002303624.1| ubiquitin conjugating-like enzyme family protein [Populus trichocarpa] gi|118487400|gb|ABK95528.1| unknown [Populus trichocarpa] gi|222841056|gb|EEE78603.1| ubiquitin conjugating-like enzyme family protein [Populus trichocarpa] gi|564587035|gb|AHB86964.1| ubiquitin conjugating enzyme 9 [Sedum alfredii] Length = 148 Score = 66.6 bits (161), Expect(2) = 9e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 119 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 Score = 25.4 bits (54), Expect(2) = 9e-11 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 111 TDPNPDDPL 119 >ref|NP_001235332.1| uncharacterized protein LOC100305945 [Glycine max] gi|224058407|ref|XP_002299494.1| ubiquitin conjugating-like enzyme family protein [Populus trichocarpa] gi|225426040|ref|XP_002274274.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 1 [Vitis vinifera] gi|225462705|ref|XP_002267153.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Vitis vinifera] gi|357512493|ref|XP_003626535.1| Ubiquitin carrier protein [Medicago truncatula] gi|359474069|ref|XP_003631397.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 2 [Vitis vinifera] gi|470141980|ref|XP_004306700.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Fragaria vesca subsp. vesca] gi|567893840|ref|XP_006439408.1| hypothetical protein CICLE_v10022710mg [Citrus clementina] gi|567893842|ref|XP_006439409.1| hypothetical protein CICLE_v10022710mg [Citrus clementina] gi|567893844|ref|XP_006439410.1| hypothetical protein CICLE_v10022710mg [Citrus clementina] gi|568845141|ref|XP_006476436.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform X1 [Citrus sinensis] gi|568845143|ref|XP_006476437.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform X2 [Citrus sinensis] gi|571560602|ref|XP_006604881.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Glycine max] gi|586723595|ref|XP_006849364.1| hypothetical protein AMTR_s00158p00046520 [Amborella trichopoda] gi|590678887|ref|XP_007040427.1| Ubiquitin carrier protein isoform 1 [Theobroma cacao] gi|590678891|ref|XP_007040428.1| Ubiquitin carrier protein isoform 2, partial [Theobroma cacao] gi|593693504|ref|XP_007147273.1| hypothetical protein PHAVU_006G110100g [Phaseolus vulgaris] gi|118485959|gb|ABK94824.1| unknown [Populus trichocarpa] gi|217075220|gb|ACJ85970.1| unknown [Medicago truncatula] gi|222846752|gb|EEE84299.1| ubiquitin conjugating-like enzyme family protein [Populus trichocarpa] gi|224812550|gb|ACN64930.1| ubiquitin-conjugating enzyme E2 [Vigna radiata] gi|255627069|gb|ACU13879.1| unknown [Glycine max] gi|297742298|emb|CBI34447.3| unnamed protein product [Vitis vinifera] gi|302143696|emb|CBI22557.3| unnamed protein product [Vitis vinifera] gi|355501550|gb|AES82753.1| Ubiquitin carrier protein [Medicago truncatula] gi|388499224|gb|AFK37678.1| unknown [Medicago truncatula] gi|388515339|gb|AFK45731.1| unknown [Medicago truncatula] gi|508777672|gb|EOY24928.1| Ubiquitin carrier protein isoform 1 [Theobroma cacao] gi|508777673|gb|EOY24929.1| Ubiquitin carrier protein isoform 2, partial [Theobroma cacao] gi|548852911|gb|ERN10945.1| hypothetical protein AMTR_s00158p00046520 [Amborella trichopoda] gi|557541670|gb|ESR52648.1| hypothetical protein CICLE_v10022710mg [Citrus clementina] gi|557541671|gb|ESR52649.1| hypothetical protein CICLE_v10022710mg [Citrus clementina] gi|557541672|gb|ESR52650.1| hypothetical protein CICLE_v10022710mg [Citrus clementina] gi|561020496|gb|ESW19267.1| hypothetical protein PHAVU_006G110100g [Phaseolus vulgaris] gi|604306132|gb|EYU25189.1| hypothetical protein MIMGU_mgv1a015707mg [Mimulus guttatus] gi|604306133|gb|EYU25190.1| hypothetical protein MIMGU_mgv1a015707mg [Mimulus guttatus] Length = 148 Score = 66.6 bits (161), Expect(2) = 9e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 119 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 Score = 25.4 bits (54), Expect(2) = 9e-11 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 111 TDPNPDDPL 119 >gb|AAY29571.1| immature spike ubiquitin-conjugating enzyme 2 [Triticum aestivum] Length = 148 Score = 66.6 bits (161), Expect(2) = 9e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 119 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 Score = 25.4 bits (54), Expect(2) = 9e-11 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 111 TDPNPDDPL 119 >gb|EYU36894.1| hypothetical protein MIMGU_mgv1a015751mg [Mimulus guttatus] Length = 147 Score = 66.6 bits (161), Expect(2) = 9e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 118 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 147 Score = 25.4 bits (54), Expect(2) = 9e-11 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 110 TDPNPDDPL 118 >gb|AFY06649.1| ubiquitin conjugating enzyme, partial [Carica papaya] Length = 124 Score = 66.6 bits (161), Expect(2) = 9e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 95 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 124 Score = 25.4 bits (54), Expect(2) = 9e-11 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 87 TDPNPDDPL 95 >ref|XP_006385788.1| hypothetical protein POPTR_0003s13600g [Populus trichocarpa] gi|550343111|gb|ERP63585.1| hypothetical protein POPTR_0003s13600g [Populus trichocarpa] Length = 107 Score = 66.6 bits (161), Expect(2) = 9e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 78 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 107 Score = 25.4 bits (54), Expect(2) = 9e-11 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 70 TDPNPDDPL 78 >ref|XP_004252497.1| PREDICTED: uncharacterized protein LOC101254461 [Solanum lycopersicum] Length = 182 Score = 65.5 bits (158), Expect(2) = 2e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDR+KYETTARSWTQKYAMG Sbjct: 153 LVPEIAHMYKTDRAKYETTARSWTQKYAMG 182 Score = 25.4 bits (54), Expect(2) = 2e-10 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 145 TDPNPDDPL 153 >gb|EXB72469.1| Ubiquitin-conjugating enzyme E2 10 [Morus notabilis] Length = 168 Score = 65.5 bits (158), Expect(2) = 2e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDR+KYETTARSWTQKYAMG Sbjct: 139 LVPEIAHMYKTDRNKYETTARSWTQKYAMG 168 Score = 25.4 bits (54), Expect(2) = 2e-10 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 131 TDPNPDDPL 139 >gb|EXC02953.1| Ubiquitin-conjugating enzyme E2 10 [Morus notabilis] Length = 167 Score = 65.5 bits (158), Expect(2) = 2e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDR+KYETTARSWTQKYAMG Sbjct: 138 LVPEIAHMYKTDRNKYETTARSWTQKYAMG 167 Score = 25.4 bits (54), Expect(2) = 2e-10 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 130 TDPNPDDPL 138 >ref|XP_004308017.1| PREDICTED: ubiquitin-conjugating enzyme E2 10-like isoform 1 [Fragaria vesca subsp. vesca] Length = 167 Score = 65.5 bits (158), Expect(2) = 2e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDR+KYETTARSWTQKYAMG Sbjct: 138 LVPEIAHMYKTDRNKYETTARSWTQKYAMG 167 Score = 25.4 bits (54), Expect(2) = 2e-10 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 130 TDPNPDDPL 138 >ref|XP_007218529.1| hypothetical protein PRUPE_ppa012628mg [Prunus persica] gi|462414991|gb|EMJ19728.1| hypothetical protein PRUPE_ppa012628mg [Prunus persica] Length = 160 Score = 65.5 bits (158), Expect(2) = 2e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDR+KYETTARSWTQKYAMG Sbjct: 131 LVPEIAHMYKTDRNKYETTARSWTQKYAMG 160 Score = 25.4 bits (54), Expect(2) = 2e-10 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 123 TDPNPDDPL 131 >ref|XP_003632627.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa [Vitis vinifera] Length = 155 Score = 65.5 bits (158), Expect(2) = 2e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDR+KYETTARSWTQKYAMG Sbjct: 126 LVPEIAHMYKTDRAKYETTARSWTQKYAMG 155 Score = 25.4 bits (54), Expect(2) = 2e-10 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 118 TDPNPDDPL 126 >gb|EYU19615.1| hypothetical protein MIMGU_mgv1a015722mg [Mimulus guttatus] Length = 148 Score = 65.5 bits (158), Expect(2) = 2e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 28 LVPEIAHMYKTDRSKYETTARSWTQKYAMG 117 LVPEIAHMYKTDR+KYETTARSWTQKYAMG Sbjct: 119 LVPEIAHMYKTDRNKYETTARSWTQKYAMG 148 Score = 25.4 bits (54), Expect(2) = 2e-10 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 3 TDPNPDDPL 29 TDPNPDDPL Sbjct: 111 TDPNPDDPL 119