BLASTX nr result
ID: Mentha25_contig00024528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00024528 (495 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19874.1| hypothetical protein MIMGU_mgv1a000669mg [Mimulus... 62 8e-08 >gb|EYU19874.1| hypothetical protein MIMGU_mgv1a000669mg [Mimulus guttatus] Length = 1024 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 15 YCSSDEIISNFSAMPQTYSAIALWLVKLDLLVASRSHVETCH 140 Y +SDEIISNFS +PQTYSA+ALWLVKLDLLVA H E+ H Sbjct: 967 YSASDEIISNFSTVPQTYSAVALWLVKLDLLVA--PHAESGH 1006