BLASTX nr result
ID: Mentha25_contig00023730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00023730 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46488.1| hypothetical protein MIMGU_mgv1a008523mg [Mimulus... 67 3e-09 >gb|EYU46488.1| hypothetical protein MIMGU_mgv1a008523mg [Mimulus guttatus] Length = 371 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/56 (55%), Positives = 42/56 (75%) Frame = -3 Query: 326 WEELLKAHSDEDKITLLTKVAVNGNSSHVQLASLQKVVPELIPKLECAERKKVEAC 159 W ELLK+HS +ITLL K+AVNGN + ++ A +Q VV EL+P+LECA+ +V AC Sbjct: 316 WVELLKSHSGAQEITLLAKLAVNGNHNWLRRAPMQNVVSELLPRLECAQTNQVGAC 371