BLASTX nr result
ID: Mentha25_contig00023479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00023479 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33445.1| hypothetical protein MIMGU_mgv1a005903mg [Mimulus... 56 6e-06 >gb|EYU33445.1| hypothetical protein MIMGU_mgv1a005903mg [Mimulus guttatus] Length = 465 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/55 (52%), Positives = 38/55 (69%), Gaps = 10/55 (18%) Frame = +3 Query: 6 NVIPEGVPLS--SEFW-----HQPS---QTNNTNFPEIQLFITPYETDLYSNLMN 140 + IPEG+PLS SEFW HQ + +TN+ N+ EIQL +TPYE D YSN++N Sbjct: 411 HTIPEGIPLSAGSEFWLSTAGHQSTHHHRTNSNNYDEIQLSVTPYEPDFYSNILN 465