BLASTX nr result
ID: Mentha25_contig00023164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00023164 (408 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31395.1| hypothetical protein MIMGU_mgv1a005139mg [Mimulus... 61 2e-07 gb|ACN31574.1| unknown [Zea mays] 60 2e-07 ref|NP_001141545.1| uncharacterized protein LOC100273659 [Zea ma... 60 2e-07 gb|ACF79682.1| unknown [Zea mays] 60 2e-07 dbj|BAA11214.1| cytosolic glutathione reductase [Oryza sativa Ja... 58 1e-06 ref|NP_001048485.1| Os02g0813500 [Oryza sativa Japonica Group] g... 58 1e-06 dbj|BAC10595.1| deoxymugineic acid synthase 2 [Hordeum vulgare s... 58 1e-06 dbj|BAC10594.1| deoxymugineic acid synthase 1 [Hordeum vulgare s... 58 1e-06 ref|XP_006360359.1| PREDICTED: glutathione reductase, cytosolic-... 58 1e-06 gb|EMT09157.1| Glutathione reductase, cytosolic [Aegilops tauschii] 58 1e-06 gb|EMS49159.1| Glutathione reductase, cytosolic [Triticum urartu] 58 1e-06 ref|XP_004247851.1| PREDICTED: glutathione reductase, cytosolic ... 58 1e-06 dbj|BAK08168.1| predicted protein [Hordeum vulgare subsp. vulgare] 58 1e-06 dbj|BAF80309.1| cytosolic glutathione reductase [Hordeum vulgare] 58 1e-06 gb|EAY87985.1| hypothetical protein OsI_09408 [Oryza sativa Indi... 58 1e-06 gb|AAQ64632.1| cytosolic glutathione reductase [Triticum monococ... 58 1e-06 ref|XP_004954330.1| PREDICTED: glutathione reductase, cytosolic-... 58 2e-06 ref|XP_006599444.1| PREDICTED: glutathione reductase, cytosolic-... 57 4e-06 ref|XP_007222141.1| hypothetical protein PRUPE_ppa004673mg [Prun... 57 4e-06 ref|XP_003548073.1| PREDICTED: glutathione reductase, cytosolic-... 57 4e-06 >gb|EYU31395.1| hypothetical protein MIMGU_mgv1a005139mg [Mimulus guttatus] Length = 495 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRISPTKPKTNL 308 D T+GIHPSAAEEFVTMRSVTRR+S +KPKTNL Sbjct: 463 DGTVGIHPSAAEEFVTMRSVTRRVSASKPKTNL 495 >gb|ACN31574.1| unknown [Zea mays] Length = 149 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/34 (85%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRISPT-KPKTNL 308 D+T+GIHPSAAEEFVTMR+VTRR+SPT KPKTNL Sbjct: 116 DSTVGIHPSAAEEFVTMRTVTRRLSPTSKPKTNL 149 >ref|NP_001141545.1| uncharacterized protein LOC100273659 [Zea mays] gi|194705010|gb|ACF86589.1| unknown [Zea mays] gi|413939432|gb|AFW73983.1| hypothetical protein ZEAMMB73_631326 [Zea mays] gi|413939433|gb|AFW73984.1| hypothetical protein ZEAMMB73_631326 [Zea mays] Length = 495 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/34 (85%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRISPT-KPKTNL 308 D+T+GIHPSAAEEFVTMR+VTRR+SPT KPKTNL Sbjct: 462 DSTVGIHPSAAEEFVTMRTVTRRLSPTSKPKTNL 495 >gb|ACF79682.1| unknown [Zea mays] Length = 89 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/34 (85%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRISPT-KPKTNL 308 D+T+GIHPSAAEEFVTMR+VTRR+SPT KPKTNL Sbjct: 56 DSTVGIHPSAAEEFVTMRTVTRRLSPTSKPKTNL 89 >dbj|BAA11214.1| cytosolic glutathione reductase [Oryza sativa Japonica Group] Length = 496 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRISP-TKPKTNL 308 D+T+GIHPSAAEEFVTMR++TRR+SP +KPKTNL Sbjct: 463 DSTVGIHPSAAEEFVTMRTLTRRVSPSSKPKTNL 496 >ref|NP_001048485.1| Os02g0813500 [Oryza sativa Japonica Group] gi|19860133|sp|P48642.2|GSHRC_ORYSJ RecName: Full=Glutathione reductase, cytosolic; Short=GR; Short=GRase gi|4106694|dbj|BAA36283.1| cytosolic glutathione reductase [Oryza sativa Japonica Group] gi|4153883|dbj|BAA37092.1| cytosolic glutathione reductase [Oryza sativa Japonica Group] gi|47847860|dbj|BAD21653.1| glutathione reductase [Oryza sativa Japonica Group] gi|47848540|dbj|BAD22392.1| glutathione reductase [Oryza sativa Japonica Group] gi|113538016|dbj|BAF10399.1| Os02g0813500 [Oryza sativa Japonica Group] gi|125584119|gb|EAZ25050.1| hypothetical protein OsJ_08842 [Oryza sativa Japonica Group] Length = 496 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRISP-TKPKTNL 308 D+T+GIHPSAAEEFVTMR++TRR+SP +KPKTNL Sbjct: 463 DSTVGIHPSAAEEFVTMRTLTRRVSPSSKPKTNL 496 >dbj|BAC10595.1| deoxymugineic acid synthase 2 [Hordeum vulgare subsp. vulgare] Length = 254 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRISP-TKPKTNL 308 D+T+GIHPSAAEEFVTMR++TRR+SP +KPKTNL Sbjct: 221 DSTVGIHPSAAEEFVTMRTLTRRVSPASKPKTNL 254 >dbj|BAC10594.1| deoxymugineic acid synthase 1 [Hordeum vulgare subsp. vulgare] Length = 359 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRISP-TKPKTNL 308 D+T+GIHPSAAEEFVTMR++TRR+SP +KPKTNL Sbjct: 326 DSTVGIHPSAAEEFVTMRTLTRRVSPASKPKTNL 359 >ref|XP_006360359.1| PREDICTED: glutathione reductase, cytosolic-like isoform X1 [Solanum tuberosum] gi|565389225|ref|XP_006360360.1| PREDICTED: glutathione reductase, cytosolic-like isoform X2 [Solanum tuberosum] Length = 495 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRISPTKPKTNL 308 D+T+GIHPSAAEEFVTMRS +RRIS KPKTNL Sbjct: 463 DSTVGIHPSAAEEFVTMRSESRRISSNKPKTNL 495 >gb|EMT09157.1| Glutathione reductase, cytosolic [Aegilops tauschii] Length = 537 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRIS-PTKPKTNL 308 D+T+GIHPSAAEEFVTMR++TRR+S P+KPKTNL Sbjct: 504 DSTVGIHPSAAEEFVTMRTLTRRVSPPSKPKTNL 537 >gb|EMS49159.1| Glutathione reductase, cytosolic [Triticum urartu] Length = 745 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRIS-PTKPKTNL 308 D+T+GIHPSAAEEFVTMR++TRR+S P+KPKTNL Sbjct: 453 DSTVGIHPSAAEEFVTMRTLTRRVSPPSKPKTNL 486 >ref|XP_004247851.1| PREDICTED: glutathione reductase, cytosolic isoform 1 [Solanum lycopersicum] gi|460404767|ref|XP_004247852.1| PREDICTED: glutathione reductase, cytosolic isoform 2 [Solanum lycopersicum] Length = 495 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRISPTKPKTNL 308 D+T+GIHPSAAEEFVTMRS +RRIS KPKTNL Sbjct: 463 DSTVGIHPSAAEEFVTMRSESRRISSNKPKTNL 495 >dbj|BAK08168.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 497 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRISP-TKPKTNL 308 D+T+GIHPSAAEEFVTMR++TRR+SP +KPKTNL Sbjct: 464 DSTVGIHPSAAEEFVTMRTLTRRVSPASKPKTNL 497 >dbj|BAF80309.1| cytosolic glutathione reductase [Hordeum vulgare] Length = 497 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRISP-TKPKTNL 308 D+T+GIHPSAAEEFVTMR++TRR+SP +KPKTNL Sbjct: 464 DSTVGIHPSAAEEFVTMRTLTRRVSPASKPKTNL 497 >gb|EAY87985.1| hypothetical protein OsI_09408 [Oryza sativa Indica Group] Length = 553 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRISP-TKPKTNL 308 D+T+GIHPSAAEEFVTMR++TRR+SP +KPKTNL Sbjct: 520 DSTVGIHPSAAEEFVTMRTLTRRVSPSSKPKTNL 553 >gb|AAQ64632.1| cytosolic glutathione reductase [Triticum monococcum] Length = 496 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRIS-PTKPKTNL 308 D+T+GIHPSAAEEFVTMR++TRR+S P+KPKTNL Sbjct: 463 DSTVGIHPSAAEEFVTMRTLTRRVSPPSKPKTNL 496 >ref|XP_004954330.1| PREDICTED: glutathione reductase, cytosolic-like [Setaria italica] Length = 494 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/34 (79%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRISPT-KPKTNL 308 D+T+GIHPSAAEEFVTMR++TRR+SPT KPKT+L Sbjct: 461 DSTVGIHPSAAEEFVTMRTLTRRVSPTSKPKTSL 494 >ref|XP_006599444.1| PREDICTED: glutathione reductase, cytosolic-like isoform X2 [Glycine max] Length = 512 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/36 (77%), Positives = 32/36 (88%), Gaps = 3/36 (8%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRISPT---KPKTNL 308 D+T+GIHPSAAEEFVTMRSVTRR++ T KPKTNL Sbjct: 477 DSTVGIHPSAAEEFVTMRSVTRRVAGTGSVKPKTNL 512 >ref|XP_007222141.1| hypothetical protein PRUPE_ppa004673mg [Prunus persica] gi|596129772|ref|XP_007222142.1| hypothetical protein PRUPE_ppa004673mg [Prunus persica] gi|462419077|gb|EMJ23340.1| hypothetical protein PRUPE_ppa004673mg [Prunus persica] gi|462419078|gb|EMJ23341.1| hypothetical protein PRUPE_ppa004673mg [Prunus persica] Length = 496 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRISP-TKPKTNL 308 D+T+GIHPSAAEEFVTMRSVTRRI+ +KPKTNL Sbjct: 463 DSTVGIHPSAAEEFVTMRSVTRRIAAGSKPKTNL 496 >ref|XP_003548073.1| PREDICTED: glutathione reductase, cytosolic-like isoform X1 [Glycine max] gi|571528724|ref|XP_006599445.1| PREDICTED: glutathione reductase, cytosolic-like isoform X3 [Glycine max] Length = 501 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/36 (77%), Positives = 32/36 (88%), Gaps = 3/36 (8%) Frame = -3 Query: 406 DTTIGIHPSAAEEFVTMRSVTRRISPT---KPKTNL 308 D+T+GIHPSAAEEFVTMRSVTRR++ T KPKTNL Sbjct: 466 DSTVGIHPSAAEEFVTMRSVTRRVAGTGSVKPKTNL 501