BLASTX nr result
ID: Mentha25_contig00023138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00023138 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46861.1| hypothetical protein MIMGU_mgv1a012509mg [Mimulus... 57 3e-06 >gb|EYU46861.1| hypothetical protein MIMGU_mgv1a012509mg [Mimulus guttatus] Length = 248 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 4/45 (8%) Frame = -3 Query: 126 FAKRVLLASRFYAPPN----RTFHKHLTGVKFRRPFSPVMEWQDC 4 F K+++ SR+YAP RT H LTGVK RRPF+PVMEWQDC Sbjct: 58 FTKKLVRFSRYYAPQTQTQKRTSHYSLTGVKSRRPFTPVMEWQDC 102