BLASTX nr result
ID: Mentha25_contig00021994
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00021994 (594 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29338.1| hypothetical protein MIMGU_mgv1a005030mg [Mimulus... 61 2e-07 >gb|EYU29338.1| hypothetical protein MIMGU_mgv1a005030mg [Mimulus guttatus] Length = 500 Score = 61.2 bits (147), Expect = 2e-07 Identities = 36/56 (64%), Positives = 40/56 (71%), Gaps = 7/56 (12%) Frame = -1 Query: 591 PEDFSFVGYTYKNFDAIKEALRNKSGEF------KEMTEETDVRMNLSMDDV-MSP 445 P+D SFVGYTYKNFDAIK ALRNKSG+ +ETDV+M SMDDV MSP Sbjct: 446 PKDLSFVGYTYKNFDAIK-ALRNKSGDSMGNQMRNRTADETDVQMMTSMDDVIMSP 500