BLASTX nr result
ID: Mentha25_contig00021966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00021966 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44863.1| hypothetical protein MIMGU_mgv1a025705mg [Mimulus... 66 4e-09 gb|EYU23510.1| hypothetical protein MIMGU_mgv1a012512mg [Mimulus... 63 5e-08 >gb|EYU44863.1| hypothetical protein MIMGU_mgv1a025705mg [Mimulus guttatus] Length = 249 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -3 Query: 323 DPVLNDGHSGEQSRDAVLDGVRKKFLERVVRERE 222 DPVLNDGH GEQSR+AVLDGVRKKFLERVVRE E Sbjct: 207 DPVLNDGHGGEQSREAVLDGVRKKFLERVVREHE 240 >gb|EYU23510.1| hypothetical protein MIMGU_mgv1a012512mg [Mimulus guttatus] Length = 248 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -3 Query: 323 DPVLNDGHSGEQSRDAVLDGVRKKFLERVVRERE 222 DPVLNDGH GEQS +AVLDGVRKKFLERVVR+ E Sbjct: 207 DPVLNDGHGGEQSTEAVLDGVRKKFLERVVRDHE 240