BLASTX nr result
ID: Mentha25_contig00020876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00020876 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42601.1| hypothetical protein MIMGU_mgv1a003028mg [Mimulus... 64 3e-13 ref|XP_006379255.1| hypothetical protein POPTR_0009s12230g [Popu... 64 2e-11 ref|XP_006365292.1| PREDICTED: phosphatidylinositol/phosphatidyl... 66 4e-09 ref|XP_006365291.1| PREDICTED: phosphatidylinositol/phosphatidyl... 66 4e-09 ref|XP_004248700.1| PREDICTED: uncharacterized protein LOC101261... 66 4e-09 ref|XP_004169138.1| PREDICTED: uncharacterized LOC101208172 [Cuc... 66 4e-09 ref|XP_004148831.1| PREDICTED: uncharacterized protein LOC101208... 66 4e-09 dbj|BAF98225.1| CM0216.430.nc [Lotus japonicus] 66 4e-09 ref|XP_007042119.1| Sec14p-like phosphatidylinositol transfer fa... 65 8e-09 ref|XP_007042117.1| Sec14p-like phosphatidylinositol transfer fa... 65 8e-09 ref|XP_006365129.1| PREDICTED: phosphatidylinositol/phosphatidyl... 65 1e-08 ref|XP_004230868.1| PREDICTED: uncharacterized protein LOC101265... 65 1e-08 ref|XP_004230867.1| PREDICTED: uncharacterized protein LOC101265... 65 1e-08 ref|XP_002512943.1| phosphatidylinositol transporter, putative [... 65 1e-08 ref|XP_007135957.1| hypothetical protein PHAVU_009G006000g [Phas... 64 2e-08 ref|XP_007135956.1| hypothetical protein PHAVU_009G006000g [Phas... 64 2e-08 ref|XP_003527164.1| PREDICTED: phosphatidylinositol/phosphatidyl... 63 4e-08 ref|XP_003522898.1| PREDICTED: phosphatidylinositol/phosphatidyl... 63 4e-08 gb|AAK63247.1|AF367433_1 phosphatidylinositol transfer-like prot... 63 4e-08 ref|XP_002283681.2| PREDICTED: uncharacterized protein LOC100252... 63 5e-08 >gb|EYU42601.1| hypothetical protein MIMGU_mgv1a003028mg [Mimulus guttatus] Length = 614 Score = 64.3 bits (155), Expect(2) = 3e-13 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 121 DTEILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 D E+LS VLKRLGELEEKV++LQ KPSEMP+EKEELL AA Sbjct: 528 DAELLSSVLKRLGELEEKVTSLQEKPSEMPYEKEELLYAA 567 Score = 36.2 bits (82), Expect(2) = 3e-13 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = -2 Query: 327 KKQTNTEKSFVSEG--PPPASQKAPARFSPHVLAAVMTFLMTLF 202 KKQT E+ +S+ P P S+KAP +LAA+MTF LF Sbjct: 447 KKQTTPERLNISKEKLPSPDSRKAPESLYARILAALMTFFTALF 490 >ref|XP_006379255.1| hypothetical protein POPTR_0009s12230g [Populus trichocarpa] gi|550331574|gb|ERP57052.1| hypothetical protein POPTR_0009s12230g [Populus trichocarpa] Length = 531 Score = 63.5 bits (153), Expect(2) = 2e-11 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -1 Query: 121 DTEILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 + ++LS VLKRLGELEEKV TLQ+KPS MP+EKEELLNAA Sbjct: 444 EADLLSSVLKRLGELEEKVDTLQAKPSVMPYEKEELLNAA 483 Score = 30.8 bits (68), Expect(2) = 2e-11 Identities = 22/77 (28%), Positives = 31/77 (40%), Gaps = 2/77 (2%) Frame = -2 Query: 327 KKQTNTEKSFVSEG--PPPASQKAPARFSPHVLAAVMTFLMTLFXXXXXXXXXXXXSKPH 154 KKQ + ++ VS+ P P + K P + AV+ F MTL PH Sbjct: 352 KKQASIQRPSVSKATTPQPNTGKTPEGVHVRICVAVVAFFMTLLTLFRSLKSQVTKRLPH 411 Query: 153 FQARTSDCSQGTQKSYL 103 SDC Q + + L Sbjct: 412 ---TLSDCDQSSPEPAL 425 >ref|XP_006365292.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like isoform X2 [Solanum tuberosum] Length = 622 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/40 (77%), Positives = 38/40 (95%) Frame = -1 Query: 121 DTEILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 + ++LS+VLK+LGELE+KVSTLQ KPSEMP+EKEELLNAA Sbjct: 536 EAQLLSVVLKKLGELEDKVSTLQEKPSEMPYEKEELLNAA 575 >ref|XP_006365291.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like isoform X1 [Solanum tuberosum] Length = 623 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/40 (77%), Positives = 38/40 (95%) Frame = -1 Query: 121 DTEILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 + ++LS+VLK+LGELE+KVSTLQ KPSEMP+EKEELLNAA Sbjct: 537 EAQLLSVVLKKLGELEDKVSTLQEKPSEMPYEKEELLNAA 576 >ref|XP_004248700.1| PREDICTED: uncharacterized protein LOC101261075 [Solanum lycopersicum] Length = 623 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/40 (77%), Positives = 38/40 (95%) Frame = -1 Query: 121 DTEILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 + ++LS+VLK+LGELE+KVSTLQ KPSEMP+EKEELLNAA Sbjct: 537 EAQLLSVVLKKLGELEDKVSTLQEKPSEMPYEKEELLNAA 576 >ref|XP_004169138.1| PREDICTED: uncharacterized LOC101208172 [Cucumis sativus] Length = 623 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -1 Query: 121 DTEILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 + E+LS ++KRLGELEEKV TLQSKPSEMP+EKEELLNAA Sbjct: 537 EAELLSNLMKRLGELEEKVDTLQSKPSEMPYEKEELLNAA 576 >ref|XP_004148831.1| PREDICTED: uncharacterized protein LOC101208172 [Cucumis sativus] Length = 623 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -1 Query: 121 DTEILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 + E+LS ++KRLGELEEKV TLQSKPSEMP+EKEELLNAA Sbjct: 537 EAELLSNLMKRLGELEEKVDTLQSKPSEMPYEKEELLNAA 576 >dbj|BAF98225.1| CM0216.430.nc [Lotus japonicus] Length = 631 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = -1 Query: 148 SEDLRLQSRDTEILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 S L + ++LS ++KRLGELEEKV TLQSKPSEMP+EKEELLNAA Sbjct: 535 SSSLTAAHTEADLLSSMMKRLGELEEKVETLQSKPSEMPNEKEELLNAA 583 >ref|XP_007042119.1| Sec14p-like phosphatidylinositol transfer family protein isoform 3 [Theobroma cacao] gi|508706054|gb|EOX97950.1| Sec14p-like phosphatidylinositol transfer family protein isoform 3 [Theobroma cacao] Length = 641 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 115 EILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 ++LS VLKRLGELEEKV TLQ+KPSEMP+EKEELLNAA Sbjct: 542 DLLSSVLKRLGELEEKVDTLQAKPSEMPYEKEELLNAA 579 >ref|XP_007042117.1| Sec14p-like phosphatidylinositol transfer family protein isoform 1 [Theobroma cacao] gi|590685507|ref|XP_007042118.1| Sec14p-like phosphatidylinositol transfer family protein isoform 1 [Theobroma cacao] gi|508706052|gb|EOX97948.1| Sec14p-like phosphatidylinositol transfer family protein isoform 1 [Theobroma cacao] gi|508706053|gb|EOX97949.1| Sec14p-like phosphatidylinositol transfer family protein isoform 1 [Theobroma cacao] Length = 626 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 115 EILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 ++LS VLKRLGELEEKV TLQ+KPSEMP+EKEELLNAA Sbjct: 542 DLLSSVLKRLGELEEKVDTLQAKPSEMPYEKEELLNAA 579 >ref|XP_006365129.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like [Solanum tuberosum] Length = 625 Score = 64.7 bits (156), Expect = 1e-08 Identities = 34/55 (61%), Positives = 42/55 (76%), Gaps = 5/55 (9%) Frame = -1 Query: 151 PSEDLRLQS-----RDTEILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 P E+ R S + ++LS+VLKRLGELE+KV+TLQ KPSEMP+EK ELLNAA Sbjct: 523 PKEEFRPPSPTPAFTEAQLLSVVLKRLGELEDKVNTLQEKPSEMPYEKAELLNAA 577 >ref|XP_004230868.1| PREDICTED: uncharacterized protein LOC101265778 isoform 2 [Solanum lycopersicum] Length = 625 Score = 64.7 bits (156), Expect = 1e-08 Identities = 34/55 (61%), Positives = 42/55 (76%), Gaps = 5/55 (9%) Frame = -1 Query: 151 PSEDLRLQS-----RDTEILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 P E+ R S + ++LS+VLKRLGELE+KV+TLQ KPSEMP+EK ELLNAA Sbjct: 523 PKEEFRPPSPTPAFTEAQLLSVVLKRLGELEDKVNTLQEKPSEMPYEKAELLNAA 577 >ref|XP_004230867.1| PREDICTED: uncharacterized protein LOC101265778 isoform 1 [Solanum lycopersicum] Length = 628 Score = 64.7 bits (156), Expect = 1e-08 Identities = 34/55 (61%), Positives = 42/55 (76%), Gaps = 5/55 (9%) Frame = -1 Query: 151 PSEDLRLQS-----RDTEILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 P E+ R S + ++LS+VLKRLGELE+KV+TLQ KPSEMP+EK ELLNAA Sbjct: 526 PKEEFRPPSPTPAFTEAQLLSVVLKRLGELEDKVNTLQEKPSEMPYEKAELLNAA 580 >ref|XP_002512943.1| phosphatidylinositol transporter, putative [Ricinus communis] gi|223547954|gb|EEF49446.1| phosphatidylinositol transporter, putative [Ricinus communis] Length = 624 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -1 Query: 121 DTEILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 + ++LS VLKRLGELEEKV TL++KPSEMP+EKEELLNAA Sbjct: 538 EADLLSSVLKRLGELEEKVDTLKAKPSEMPYEKEELLNAA 577 >ref|XP_007135957.1| hypothetical protein PHAVU_009G006000g [Phaseolus vulgaris] gi|561009044|gb|ESW07951.1| hypothetical protein PHAVU_009G006000g [Phaseolus vulgaris] Length = 498 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -1 Query: 130 QSRDTEILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 Q + +L +LKRLGELEEKV TLQSKPSEMP+EKEELLNAA Sbjct: 409 QCTEENLLPSMLKRLGELEEKVDTLQSKPSEMPYEKEELLNAA 451 >ref|XP_007135956.1| hypothetical protein PHAVU_009G006000g [Phaseolus vulgaris] gi|561009043|gb|ESW07950.1| hypothetical protein PHAVU_009G006000g [Phaseolus vulgaris] Length = 625 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -1 Query: 130 QSRDTEILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 Q + +L +LKRLGELEEKV TLQSKPSEMP+EKEELLNAA Sbjct: 536 QCTEENLLPSMLKRLGELEEKVDTLQSKPSEMPYEKEELLNAA 578 >ref|XP_003527164.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like [Glycine max] Length = 623 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -1 Query: 121 DTEILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 + +L +LKRLGELEEKV TLQSKPSEMP+EKEELLNAA Sbjct: 537 EENLLPSMLKRLGELEEKVDTLQSKPSEMPYEKEELLNAA 576 >ref|XP_003522898.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like [Glycine max] Length = 624 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -1 Query: 121 DTEILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 + +L +LKRLGELEEKV TLQSKPSEMP+EKEELLNAA Sbjct: 538 EENLLPSMLKRLGELEEKVDTLQSKPSEMPYEKEELLNAA 577 >gb|AAK63247.1|AF367433_1 phosphatidylinositol transfer-like protein III [Lotus japonicus] Length = 625 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -1 Query: 121 DTEILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 + +L +LKRLGELEEKV TLQSKPSEMP+EKEELLNAA Sbjct: 539 EENLLPSMLKRLGELEEKVDTLQSKPSEMPYEKEELLNAA 578 >ref|XP_002283681.2| PREDICTED: uncharacterized protein LOC100252199 [Vitis vinifera] gi|297744421|emb|CBI37683.3| unnamed protein product [Vitis vinifera] Length = 625 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -1 Query: 121 DTEILSLVLKRLGELEEKVSTLQSKPSEMPHEKEELLNAA 2 + ++LS VLK+L ELEEKV TLQ+KPSEMP+EKEELLNAA Sbjct: 539 EADLLSSVLKKLSELEEKVDTLQAKPSEMPYEKEELLNAA 578