BLASTX nr result
ID: Mentha25_contig00020849
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00020849 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32189.1| hypothetical protein MIMGU_mgv1a011479mg [Mimulus... 66 6e-09 >gb|EYU32189.1| hypothetical protein MIMGU_mgv1a011479mg [Mimulus guttatus] Length = 280 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/54 (57%), Positives = 40/54 (74%) Frame = -2 Query: 307 EQLLQSIGCPSTPKPTYFELSPPSTTNIVPLMKLSAVKYYVASLLTRILKSEAD 146 E L+QSI CPSTPKPTYFE S ST NI+PL K +A+K+ + S+L R +SE + Sbjct: 226 EHLIQSISCPSTPKPTYFEFSSSSTMNILPLKKFAALKWNLPSVLIRHQRSETE 279