BLASTX nr result
ID: Mentha25_contig00020617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00020617 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007209304.1| hypothetical protein PRUPE_ppa007851mg [Prun... 57 3e-06 gb|EPS69991.1| hypothetical protein M569_04771 [Genlisea aurea] 56 6e-06 >ref|XP_007209304.1| hypothetical protein PRUPE_ppa007851mg [Prunus persica] gi|462405039|gb|EMJ10503.1| hypothetical protein PRUPE_ppa007851mg [Prunus persica] Length = 353 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/43 (60%), Positives = 30/43 (69%), Gaps = 3/43 (6%) Frame = -1 Query: 121 DEWGEKTEPEPEVTSKFSGPDPPIDDDEWGGSG---VELGNGS 2 DEWGE+ PE E SK S DPP ++DEWGG G VE+GNGS Sbjct: 69 DEWGEEAAPEAEPASKVSESDPPQNEDEWGGGGDDVVEIGNGS 111 >gb|EPS69991.1| hypothetical protein M569_04771 [Genlisea aurea] Length = 325 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/44 (61%), Positives = 29/44 (65%), Gaps = 2/44 (4%) Frame = -1 Query: 127 FVDEWGEKTEPEPEVTSKFSGPDPPIDDDEWGGSGVE--LGNGS 2 F DEWGEK+EPEPE +F PDPP DEW SGVE NGS Sbjct: 49 FTDEWGEKSEPEPEPKLRFPDPDPPKIVDEWEASGVEPSSSNGS 92