BLASTX nr result
ID: Mentha25_contig00020551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00020551 (555 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34737.1| hypothetical protein MIMGU_mgv1a002326mg [Mimulus... 73 4e-11 ref|XP_002300056.1| GPI transamidase component family protein [P... 70 3e-10 ref|XP_006470242.1| PREDICTED: glycosylphosphatidylinositol anch... 69 1e-09 ref|XP_006446587.1| hypothetical protein CICLE_v10014455mg [Citr... 69 1e-09 ref|XP_006446586.1| hypothetical protein CICLE_v10014455mg [Citr... 69 1e-09 ref|XP_007214987.1| hypothetical protein PRUPE_ppa002024mg [Prun... 67 2e-09 ref|XP_002274196.2| PREDICTED: glycosylphosphatidylinositol anch... 67 2e-09 emb|CBI34867.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_004233324.1| PREDICTED: glycosylphosphatidylinositol anch... 67 4e-09 ref|XP_006357159.1| PREDICTED: glycosylphosphatidylinositol anch... 65 9e-09 ref|XP_006357158.1| PREDICTED: glycosylphosphatidylinositol anch... 65 9e-09 ref|XP_007031574.1| GPI transamidase component family protein / ... 65 9e-09 ref|XP_006400470.1| hypothetical protein EUTSA_v10012831mg [Eutr... 64 3e-08 ref|XP_004156691.1| PREDICTED: glycosylphosphatidylinositol anch... 64 3e-08 ref|XP_006845249.1| hypothetical protein AMTR_s00005p00261230 [A... 63 4e-08 ref|XP_004489231.1| PREDICTED: glycosylphosphatidylinositol anch... 62 8e-08 ref|XP_004489230.1| PREDICTED: glycosylphosphatidylinositol anch... 62 8e-08 ref|XP_004489229.1| PREDICTED: glycosylphosphatidylinositol anch... 62 8e-08 ref|XP_004142789.1| PREDICTED: LOW QUALITY PROTEIN: glycosylphos... 62 8e-08 ref|XP_002447943.1| hypothetical protein SORBIDRAFT_06g018570 [S... 62 8e-08 >gb|EYU34737.1| hypothetical protein MIMGU_mgv1a002326mg [Mimulus guttatus] Length = 688 Score = 73.2 bits (178), Expect = 4e-11 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLHRC 105 W ESL AWNSATYIY+CMVHLPCWVLCI LLHRC Sbjct: 654 WAESLWAWNSATYIYMCMVHLPCWVLCIRTLLHRC 688 >ref|XP_002300056.1| GPI transamidase component family protein [Populus trichocarpa] gi|222847314|gb|EEE84861.1| GPI transamidase component family protein [Populus trichocarpa] Length = 716 Score = 70.5 bits (171), Expect = 3e-10 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLHRC 105 WMESL AWNSATYIYI MVHLPCWVLC+ ILLH C Sbjct: 682 WMESLWAWNSATYIYIGMVHLPCWVLCLHILLHSC 716 >ref|XP_006470242.1| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein-like [Citrus sinensis] Length = 699 Score = 68.6 bits (166), Expect = 1e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLHRC 105 W+ESL AWNSATY+YI MVHLPCWVLC+ ILLH C Sbjct: 665 WVESLWAWNSATYLYIGMVHLPCWVLCVQILLHPC 699 >ref|XP_006446587.1| hypothetical protein CICLE_v10014455mg [Citrus clementina] gi|557549198|gb|ESR59827.1| hypothetical protein CICLE_v10014455mg [Citrus clementina] Length = 699 Score = 68.6 bits (166), Expect = 1e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLHRC 105 W+ESL AWNSATY+YI MVHLPCWVLC+ ILLH C Sbjct: 665 WVESLWAWNSATYLYIGMVHLPCWVLCVQILLHPC 699 >ref|XP_006446586.1| hypothetical protein CICLE_v10014455mg [Citrus clementina] gi|557549197|gb|ESR59826.1| hypothetical protein CICLE_v10014455mg [Citrus clementina] Length = 597 Score = 68.6 bits (166), Expect = 1e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLHRC 105 W+ESL AWNSATY+YI MVHLPCWVLC+ ILLH C Sbjct: 563 WVESLWAWNSATYLYIGMVHLPCWVLCVQILLHPC 597 >ref|XP_007214987.1| hypothetical protein PRUPE_ppa002024mg [Prunus persica] gi|462411137|gb|EMJ16186.1| hypothetical protein PRUPE_ppa002024mg [Prunus persica] Length = 727 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLHRC 105 W+ESL AWNSATY+YI MV+LPCWVLCI IL HRC Sbjct: 693 WVESLWAWNSATYLYIGMVYLPCWVLCIHILFHRC 727 >ref|XP_002274196.2| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein [Vitis vinifera] Length = 701 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLHRC 105 W+ESL AWNSATY+YI MVHLPCW LCI ILLH C Sbjct: 667 WIESLWAWNSATYLYIGMVHLPCWALCIWILLHPC 701 >emb|CBI34867.3| unnamed protein product [Vitis vinifera] Length = 690 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLHRC 105 W+ESL AWNSATY+YI MVHLPCW LCI ILLH C Sbjct: 656 WIESLWAWNSATYLYIGMVHLPCWALCIWILLHPC 690 >ref|XP_004233324.1| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein-like [Solanum lycopersicum] Length = 707 Score = 66.6 bits (161), Expect = 4e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLHRC 105 W+ESL WNSATYIY+CMVHLPCWVLC+ LL+ C Sbjct: 673 WVESLWTWNSATYIYMCMVHLPCWVLCVHTLLYPC 707 >ref|XP_006357159.1| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein-like isoform X2 [Solanum tuberosum] Length = 659 Score = 65.5 bits (158), Expect = 9e-09 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLHRC 105 W+ESL WNSATYIY+CMVHLPCWVLC+ L++ C Sbjct: 625 WVESLWTWNSATYIYMCMVHLPCWVLCVHTLVYPC 659 >ref|XP_006357158.1| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein-like isoform X1 [Solanum tuberosum] Length = 704 Score = 65.5 bits (158), Expect = 9e-09 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLHRC 105 W+ESL WNSATYIY+CMVHLPCWVLC+ L++ C Sbjct: 670 WVESLWTWNSATYIYMCMVHLPCWVLCVHTLVYPC 704 >ref|XP_007031574.1| GPI transamidase component family protein / Gaa1-like family protein [Theobroma cacao] gi|508710603|gb|EOY02500.1| GPI transamidase component family protein / Gaa1-like family protein [Theobroma cacao] Length = 717 Score = 65.5 bits (158), Expect = 9e-09 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLHRC 105 W+ESL AWNSATYI+I MV+LPCWVLC+ ILLH C Sbjct: 683 WVESLWAWNSATYIFIGMVYLPCWVLCVHILLHTC 717 >ref|XP_006400470.1| hypothetical protein EUTSA_v10012831mg [Eutrema salsugineum] gi|557101560|gb|ESQ41923.1| hypothetical protein EUTSA_v10012831mg [Eutrema salsugineum] Length = 699 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLHRC 105 W+ESL AW SATY+YI MVHLPCW+LC+ IL H C Sbjct: 665 WLESLWAWKSATYLYIGMVHLPCWLLCLCILFHPC 699 >ref|XP_004156691.1| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein-like [Cucumis sativus] Length = 714 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLHRC 105 WME+L AWNSAT++Y+ MVHLPCW+LC ILLH C Sbjct: 680 WMETLWAWNSATFLYLGMVHLPCWLLCTQILLHPC 714 >ref|XP_006845249.1| hypothetical protein AMTR_s00005p00261230 [Amborella trichopoda] gi|548847762|gb|ERN06924.1| hypothetical protein AMTR_s00005p00261230 [Amborella trichopoda] Length = 598 Score = 63.2 bits (152), Expect = 4e-08 Identities = 22/33 (66%), Positives = 31/33 (93%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLH 99 W+E+L +WNSATY+Y+ +VHLPCWVLC+++LLH Sbjct: 565 WVENLWSWNSATYLYLLLVHLPCWVLCLIVLLH 597 >ref|XP_004489231.1| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein-like isoform X3 [Cicer arietinum] Length = 634 Score = 62.4 bits (150), Expect = 8e-08 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLHRC 105 W+ESL WNSATY+Y+ +VHLPCW LCI IL H C Sbjct: 600 WVESLWTWNSATYLYVGIVHLPCWALCIHILFHSC 634 >ref|XP_004489230.1| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein-like isoform X2 [Cicer arietinum] Length = 698 Score = 62.4 bits (150), Expect = 8e-08 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLHRC 105 W+ESL WNSATY+Y+ +VHLPCW LCI IL H C Sbjct: 664 WVESLWTWNSATYLYVGIVHLPCWALCIHILFHSC 698 >ref|XP_004489229.1| PREDICTED: glycosylphosphatidylinositol anchor attachment 1 protein-like isoform X1 [Cicer arietinum] Length = 708 Score = 62.4 bits (150), Expect = 8e-08 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLHRC 105 W+ESL WNSATY+Y+ +VHLPCW LCI IL H C Sbjct: 674 WVESLWTWNSATYLYVGIVHLPCWALCIHILFHSC 708 >ref|XP_004142789.1| PREDICTED: LOW QUALITY PROTEIN: glycosylphosphatidylinositol anchor attachment 1 protein-like [Cucumis sativus] Length = 714 Score = 62.4 bits (150), Expect = 8e-08 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLHRC 105 WME+L AWNSAT++Y+ MVHLPCW +C ILLH C Sbjct: 680 WMETLWAWNSATFLYLGMVHLPCWXICTQILLHPC 714 >ref|XP_002447943.1| hypothetical protein SORBIDRAFT_06g018570 [Sorghum bicolor] gi|241939126|gb|EES12271.1| hypothetical protein SORBIDRAFT_06g018570 [Sorghum bicolor] Length = 151 Score = 62.4 bits (150), Expect = 8e-08 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = +1 Query: 1 WMESLRAWNSATYIYICMVHLPCWVLCILILLHRC 105 WME L W+S TY+Y+ +VHLPCW+LCIL+LLH C Sbjct: 107 WMEFLLEWSSVTYLYLYLVHLPCWLLCILVLLHPC 141