BLASTX nr result
ID: Mentha25_contig00020547
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00020547 (356 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38634.1| hypothetical protein MIMGU_mgv1a015468mg [Mimulus... 67 3e-09 gb|EPS70665.1| hypothetical protein M569_04097 [Genlisea aurea] 59 7e-07 >gb|EYU38634.1| hypothetical protein MIMGU_mgv1a015468mg [Mimulus guttatus] Length = 157 Score = 67.0 bits (162), Expect = 3e-09 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = +1 Query: 193 MTTSSRSLIHRLAPYLSAQIRPNSRLLSSLSALHEAQLSSSESTS 327 MTTSSRSLIHRL PY+ A++R NSRLLSS SALHEA LSS ES S Sbjct: 1 MTTSSRSLIHRLTPYVFARLRQNSRLLSSSSALHEAHLSSPESPS 45 >gb|EPS70665.1| hypothetical protein M569_04097 [Genlisea aurea] Length = 158 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = +1 Query: 193 MTTSSRSLIHRLAPYLSAQIRPNSRLLSSLSALHEAQLSSSESTSP 330 M TSSRSLI R+AP L ++IR NSRLLSS ALHE++LS+ ES+SP Sbjct: 1 MATSSRSLISRIAPCLISRIRHNSRLLSSSFALHESRLSAQESSSP 46