BLASTX nr result
ID: Mentha25_contig00019654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00019654 (404 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30581.1| hypothetical protein MIMGU_mgv1a000837mg [Mimulus... 75 1e-11 >gb|EYU30581.1| hypothetical protein MIMGU_mgv1a000837mg [Mimulus guttatus] Length = 967 Score = 74.7 bits (182), Expect = 1e-11 Identities = 46/120 (38%), Positives = 67/120 (55%), Gaps = 1/120 (0%) Frame = +2 Query: 47 TQTEQTLEDVSIGNKMMTEKTRCSAGDCYAETENTIMESNHTDKDNENTENRHTXXXXXX 226 TQT+Q L+ V GNK + EKT+ SA + ++E +KD + +E + Sbjct: 570 TQTKQALDGVDTGNKTVEEKTQLSAAHAHLPA---VVEFTDVEKDIKTSEGKIEKSKRRK 626 Query: 227 XRRHTATDVQENLPVENQKVGSELLATKPT-SVFADSELDGRYVDSSQVLSRKSEEKVDE 403 R+H +DVQENLP ++QKV E L T+ + F +SE + S QVLS K EEK++E Sbjct: 627 KRKHAESDVQENLPSKDQKVDIEALTTEENLNGFVNSEQKRGHEASLQVLSSKGEEKLEE 686