BLASTX nr result
ID: Mentha25_contig00019607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00019607 (486 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006476396.1| PREDICTED: abscisic acid receptor PYL8-like ... 73 5e-11 ref|XP_006439365.1| hypothetical protein CICLE_v10022206mg [Citr... 73 5e-11 ref|XP_006439364.1| hypothetical protein CICLE_v10022206mg [Citr... 73 5e-11 ref|XP_002321450.1| hypothetical protein POPTR_0015s02210g [Popu... 73 5e-11 ref|XP_007040497.1| Regulatory components of ABA receptor 3 [The... 70 4e-10 ref|XP_004145925.1| PREDICTED: abscisic acid receptor PYL8-like ... 70 4e-10 gb|AEK99284.1| ABA receptor, partial [Cucumis sativus] 70 4e-10 ref|XP_002270037.2| PREDICTED: abscisic acid receptor PYL8 [Viti... 70 4e-10 ref|XP_002513580.1| conserved hypothetical protein [Ricinus comm... 70 4e-10 ref|XP_002304553.1| hypothetical protein POPTR_0003s13900g [Popu... 70 4e-10 emb|CBI22536.3| unnamed protein product [Vitis vinifera] 70 4e-10 emb|CBI34472.3| unnamed protein product [Vitis vinifera] 69 5e-10 ref|XP_007140995.1| hypothetical protein PHAVU_008G158300g [Phas... 69 7e-10 ref|XP_007038971.1| Regulatory components of ABA receptor 3 isof... 69 7e-10 ref|XP_007038970.1| Regulatory components of ABA receptor 3 isof... 69 7e-10 ref|XP_003541499.1| PREDICTED: abscisic acid receptor PYL8-like ... 68 1e-09 gb|EXB62204.1| hypothetical protein L484_017591 [Morus notabilis] 68 2e-09 ref|XP_004306686.1| PREDICTED: abscisic acid receptor PYL9-like ... 68 2e-09 ref|XP_007218488.1| hypothetical protein PRUPE_ppa012114mg [Prun... 68 2e-09 ref|XP_004234175.1| PREDICTED: abscisic acid receptor PYL8-like ... 68 2e-09 >ref|XP_006476396.1| PREDICTED: abscisic acid receptor PYL8-like [Citrus sinensis] Length = 197 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP Sbjct: 160 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 193 >ref|XP_006439365.1| hypothetical protein CICLE_v10022206mg [Citrus clementina] gi|557541627|gb|ESR52605.1| hypothetical protein CICLE_v10022206mg [Citrus clementina] Length = 214 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP Sbjct: 177 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 210 >ref|XP_006439364.1| hypothetical protein CICLE_v10022206mg [Citrus clementina] gi|557541626|gb|ESR52604.1| hypothetical protein CICLE_v10022206mg [Citrus clementina] Length = 197 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP Sbjct: 160 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 193 >ref|XP_002321450.1| hypothetical protein POPTR_0015s02210g [Populus trichocarpa] gi|222868446|gb|EEF05577.1| hypothetical protein POPTR_0015s02210g [Populus trichocarpa] Length = 191 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP Sbjct: 154 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 187 >ref|XP_007040497.1| Regulatory components of ABA receptor 3 [Theobroma cacao] gi|508777742|gb|EOY24998.1| Regulatory components of ABA receptor 3 [Theobroma cacao] Length = 193 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALIKCNLKSLADVSE LAVQDRTEP Sbjct: 156 KDETCYFVEALIKCNLKSLADVSERLAVQDRTEP 189 >ref|XP_004145925.1| PREDICTED: abscisic acid receptor PYL8-like [Cucumis sativus] gi|449524854|ref|XP_004169436.1| PREDICTED: abscisic acid receptor PYL8-like [Cucumis sativus] Length = 195 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALIKCNLKSLADVSE LAVQDRTEP Sbjct: 158 KDETCYFVEALIKCNLKSLADVSERLAVQDRTEP 191 >gb|AEK99284.1| ABA receptor, partial [Cucumis sativus] Length = 107 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALIKCNLKSLADVSE LAVQDRTEP Sbjct: 70 KDETCYFVEALIKCNLKSLADVSERLAVQDRTEP 103 >ref|XP_002270037.2| PREDICTED: abscisic acid receptor PYL8 [Vitis vinifera] Length = 83 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALIKCNLKSLADVSE LAVQDRTEP Sbjct: 46 KDETCYFVEALIKCNLKSLADVSERLAVQDRTEP 79 >ref|XP_002513580.1| conserved hypothetical protein [Ricinus communis] gi|223547488|gb|EEF48983.1| conserved hypothetical protein [Ricinus communis] Length = 195 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALIKCNLKSLADVSE LAVQDRTEP Sbjct: 158 KDETCYFVEALIKCNLKSLADVSERLAVQDRTEP 191 >ref|XP_002304553.1| hypothetical protein POPTR_0003s13900g [Populus trichocarpa] gi|222841985|gb|EEE79532.1| hypothetical protein POPTR_0003s13900g [Populus trichocarpa] Length = 190 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALIKCNLKSLADVSE LAVQDRTEP Sbjct: 153 KDETCYFVEALIKCNLKSLADVSERLAVQDRTEP 186 >emb|CBI22536.3| unnamed protein product [Vitis vinifera] Length = 185 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALIKCNLKSLADVSE LAVQDRTEP Sbjct: 148 KDETCYFVEALIKCNLKSLADVSERLAVQDRTEP 181 >emb|CBI34472.3| unnamed protein product [Vitis vinifera] Length = 185 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALIKCNLKSLADVSE LA+QDRTEP Sbjct: 148 KDETCYFVEALIKCNLKSLADVSERLAIQDRTEP 181 >ref|XP_007140995.1| hypothetical protein PHAVU_008G158300g [Phaseolus vulgaris] gi|561014128|gb|ESW12989.1| hypothetical protein PHAVU_008G158300g [Phaseolus vulgaris] Length = 145 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALIKCNLKSLADVSE LAVQDRTEP Sbjct: 108 KDETCYFVEALIKCNLKSLADVSEGLAVQDRTEP 141 >ref|XP_007038971.1| Regulatory components of ABA receptor 3 isoform 2 [Theobroma cacao] gi|508776216|gb|EOY23472.1| Regulatory components of ABA receptor 3 isoform 2 [Theobroma cacao] Length = 190 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALIKCNLKSLADVSE LAVQDRTEP Sbjct: 154 KDETCYFVEALIKCNLKSLADVSEGLAVQDRTEP 187 >ref|XP_007038970.1| Regulatory components of ABA receptor 3 isoform 1 [Theobroma cacao] gi|508776215|gb|EOY23471.1| Regulatory components of ABA receptor 3 isoform 1 [Theobroma cacao] Length = 254 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALIKCNLKSLADVSE LAVQDRTEP Sbjct: 218 KDETCYFVEALIKCNLKSLADVSEGLAVQDRTEP 251 >ref|XP_003541499.1| PREDICTED: abscisic acid receptor PYL8-like isoform X1 [Glycine max] Length = 191 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALIKCNLKSLADVSE +AVQDRTEP Sbjct: 154 KDETCYFVEALIKCNLKSLADVSEGIAVQDRTEP 187 >gb|EXB62204.1| hypothetical protein L484_017591 [Morus notabilis] Length = 202 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALI+CNLKSLADVSE +AVQDRTEP Sbjct: 166 KDETCYFVEALIRCNLKSLADVSERMAVQDRTEP 199 >ref|XP_004306686.1| PREDICTED: abscisic acid receptor PYL9-like [Fragaria vesca subsp. vesca] Length = 184 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALI+CNLKSLADVSE +AVQDRTEP Sbjct: 148 KDETCYFVEALIRCNLKSLADVSERMAVQDRTEP 181 >ref|XP_007218488.1| hypothetical protein PRUPE_ppa012114mg [Prunus persica] gi|462414950|gb|EMJ19687.1| hypothetical protein PRUPE_ppa012114mg [Prunus persica] Length = 183 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALI+CNLKSLADVSE +AVQDRTEP Sbjct: 147 KDETCYFVEALIRCNLKSLADVSERMAVQDRTEP 180 >ref|XP_004234175.1| PREDICTED: abscisic acid receptor PYL8-like isoform 2 [Solanum lycopersicum] Length = 185 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +3 Query: 3 KDETCYFVEALIKCNLKSLADVSEHLAVQDRTEP 104 KDETCYFVEALI CNLKSLADVSE LAVQDRTEP Sbjct: 148 KDETCYFVEALINCNLKSLADVSERLAVQDRTEP 181