BLASTX nr result
ID: Mentha25_contig00019255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00019255 (352 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26977.1| hypothetical protein MIMGU_mgv1a0145091mg, partia... 82 8e-14 ref|XP_007043940.1| Squamosa promoter-binding protein transcript... 80 2e-13 ref|XP_002511157.1| Squamosa promoter-binding protein, putative ... 79 9e-13 ref|XP_006437993.1| hypothetical protein CICLE_v10032171mg [Citr... 78 1e-12 ref|XP_006436866.1| hypothetical protein CICLE_v10031834mg [Citr... 77 3e-12 gb|ACL51016.1| squamosa promoter-binding protein [Citrus trifoli... 77 3e-12 gb|AGC92796.1| SBP-box transcription factor [Betula luminifera] 76 4e-12 ref|XP_002318746.1| hypothetical protein POPTR_0012s10260g [Popu... 76 4e-12 ref|XP_003525415.1| PREDICTED: squamosa promoter-binding-like pr... 76 6e-12 ref|XP_007160020.1| hypothetical protein PHAVU_002G286000g [Phas... 75 7e-12 ref|XP_004140535.1| PREDICTED: squamosa promoter-binding-like pr... 75 7e-12 ref|XP_002322273.2| hypothetical protein POPTR_0015s11100g [Popu... 74 2e-11 ref|XP_007209206.1| hypothetical protein PRUPE_ppa006611mg [Prun... 74 2e-11 ref|XP_002514891.1| conserved hypothetical protein [Ricinus comm... 74 2e-11 gb|EXB25256.1| Squamosa promoter-binding-like protein 13 [Morus ... 74 2e-11 ref|XP_004503742.1| PREDICTED: squamosa promoter-binding-like pr... 74 2e-11 gb|ADL36824.1| SPL domain class transcription factor [Malus dome... 74 2e-11 ref|XP_003532399.2| PREDICTED: squamosa promoter-binding-like pr... 74 3e-11 ref|XP_007224806.1| hypothetical protein PRUPE_ppa023657mg [Prun... 74 3e-11 ref|XP_006584701.1| PREDICTED: squamosa promoter-binding-like pr... 74 3e-11 >gb|EYU26977.1| hypothetical protein MIMGU_mgv1a0145091mg, partial [Mimulus guttatus] gi|604314004|gb|EYU26978.1| hypothetical protein MIMGU_mgv1a0145091mg, partial [Mimulus guttatus] Length = 153 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = +2 Query: 215 KRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSKTPKV 352 KRA+A N+ Q+A+CLVDGC ADLSLCRDYHRRHKVCE HSKT KV Sbjct: 6 KRARAPGNMTQIAHCLVDGCNADLSLCRDYHRRHKVCETHSKTSKV 51 >ref|XP_007043940.1| Squamosa promoter-binding protein transcription factor family protein, putative isoform 1 [Theobroma cacao] gi|508707875|gb|EOX99771.1| Squamosa promoter-binding protein transcription factor family protein, putative isoform 1 [Theobroma cacao] Length = 329 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +2 Query: 215 KRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSKTPKV 352 KRA+A + QV +CLVDGCTADLS CRDYHRRHKVCE HSKTPKV Sbjct: 29 KRARAPGSGNQVPSCLVDGCTADLSKCRDYHRRHKVCEVHSKTPKV 74 >ref|XP_002511157.1| Squamosa promoter-binding protein, putative [Ricinus communis] gi|223550272|gb|EEF51759.1| Squamosa promoter-binding protein, putative [Ricinus communis] Length = 382 Score = 78.6 bits (192), Expect = 9e-13 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +2 Query: 215 KRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSKTPKV 352 KRA+A N QVA CLVDGC+ADLS CRDYHRRHKVCE HSKTP+V Sbjct: 81 KRARAANNGTQVAYCLVDGCSADLSNCRDYHRRHKVCELHSKTPQV 126 >ref|XP_006437993.1| hypothetical protein CICLE_v10032171mg [Citrus clementina] gi|568861308|ref|XP_006484146.1| PREDICTED: squamosa promoter-binding-like protein 16-like isoform X1 [Citrus sinensis] gi|568861310|ref|XP_006484147.1| PREDICTED: squamosa promoter-binding-like protein 16-like isoform X2 [Citrus sinensis] gi|568861312|ref|XP_006484148.1| PREDICTED: squamosa promoter-binding-like protein 16-like isoform X3 [Citrus sinensis] gi|568861314|ref|XP_006484149.1| PREDICTED: squamosa promoter-binding-like protein 16-like isoform X4 [Citrus sinensis] gi|557540189|gb|ESR51233.1| hypothetical protein CICLE_v10032171mg [Citrus clementina] Length = 312 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = +2 Query: 215 KRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSKTPKV 352 KRA+ N Q+ +CLVDGCTADL CRDYHRRHKVCE HSKTPKV Sbjct: 10 KRARVPGNGTQIPSCLVDGCTADLGKCRDYHRRHKVCELHSKTPKV 55 >ref|XP_006436866.1| hypothetical protein CICLE_v10031834mg [Citrus clementina] gi|568880652|ref|XP_006493224.1| PREDICTED: squamosa promoter-binding-like protein 13B-like [Citrus sinensis] gi|557539062|gb|ESR50106.1| hypothetical protein CICLE_v10031834mg [Citrus clementina] Length = 379 Score = 77.0 bits (188), Expect = 3e-12 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +2 Query: 215 KRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSKTPKV 352 KRA+A N Q A+CLVDGC +DLS CRDYHRRHKVCE HSKTP+V Sbjct: 74 KRARAANNGSQTASCLVDGCDSDLSNCRDYHRRHKVCELHSKTPQV 119 >gb|ACL51016.1| squamosa promoter-binding protein [Citrus trifoliata] Length = 379 Score = 77.0 bits (188), Expect = 3e-12 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +2 Query: 215 KRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSKTPKV 352 KRA+A N Q A+CLVDGC +DLS CRDYHRRHKVCE HSKTP+V Sbjct: 74 KRARAANNGSQTASCLVDGCDSDLSNCRDYHRRHKVCELHSKTPQV 119 >gb|AGC92796.1| SBP-box transcription factor [Betula luminifera] Length = 389 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +2 Query: 215 KRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSKTPKV 352 KRA+A N Q +CLVDGCT+DLS CRDYHRRHKVCE HSKTP+V Sbjct: 79 KRARAANNGTQPVSCLVDGCTSDLSNCRDYHRRHKVCELHSKTPEV 124 >ref|XP_002318746.1| hypothetical protein POPTR_0012s10260g [Populus trichocarpa] gi|222859419|gb|EEE96966.1| hypothetical protein POPTR_0012s10260g [Populus trichocarpa] Length = 346 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = +2 Query: 215 KRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSKTPKV 352 KRA+ N QVA CLVDGC +DLS CRDYHRRHKVCE HSKTP+V Sbjct: 96 KRARGANNGTQVAMCLVDGCNSDLSTCRDYHRRHKVCELHSKTPQV 141 >ref|XP_003525415.1| PREDICTED: squamosa promoter-binding-like protein 13B-like isoformX1 [Glycine max] gi|356513429|ref|XP_003525416.1| PREDICTED: squamosa promoter-binding-like protein 13B-like isoformX2 [Glycine max] gi|571457173|ref|XP_006580611.1| PREDICTED: squamosa promoter-binding-like protein 13B-like isoform X3 [Glycine max] gi|571457176|ref|XP_006580612.1| PREDICTED: squamosa promoter-binding-like protein 13B-like isoform X4 [Glycine max] gi|571457178|ref|XP_006580613.1| PREDICTED: squamosa promoter-binding-like protein 13B-like isoform X5 [Glycine max] Length = 390 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +2 Query: 215 KRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSKTPKV 352 KRA+AL+N Q +CLVDGC ADLS CRDYHRRHKVCE HSKT +V Sbjct: 81 KRARALSNGTQTVSCLVDGCHADLSNCRDYHRRHKVCEVHSKTAQV 126 >ref|XP_007160020.1| hypothetical protein PHAVU_002G286000g [Phaseolus vulgaris] gi|593793965|ref|XP_007160021.1| hypothetical protein PHAVU_002G286000g [Phaseolus vulgaris] gi|561033435|gb|ESW32014.1| hypothetical protein PHAVU_002G286000g [Phaseolus vulgaris] gi|561033436|gb|ESW32015.1| hypothetical protein PHAVU_002G286000g [Phaseolus vulgaris] Length = 383 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/64 (54%), Positives = 41/64 (64%) Frame = +2 Query: 161 NSEFVAMEXXXXXXXXXXKRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSK 340 N + V + KRA+AL N Q +CLVDGC +DLS CRDYHRRHKVCE HSK Sbjct: 62 NKDAVGVSKITSSSSGSSKRARALGNGTQTVSCLVDGCNSDLSNCRDYHRRHKVCEVHSK 121 Query: 341 TPKV 352 T +V Sbjct: 122 TAQV 125 >ref|XP_004140535.1| PREDICTED: squamosa promoter-binding-like protein 16-like [Cucumis sativus] gi|449527568|ref|XP_004170782.1| PREDICTED: squamosa promoter-binding-like protein 16-like [Cucumis sativus] Length = 328 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = +2 Query: 215 KRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSKTPKV 352 KR++A + QV +C+VDGC++DLS CRDYHRRHKVCE HSKTPKV Sbjct: 36 KRSRAPGSGAQVPSCMVDGCSSDLSKCRDYHRRHKVCELHSKTPKV 81 >ref|XP_002322273.2| hypothetical protein POPTR_0015s11100g [Populus trichocarpa] gi|550322466|gb|EEF06400.2| hypothetical protein POPTR_0015s11100g [Populus trichocarpa] Length = 381 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +2 Query: 215 KRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSKTPKV 352 KRA+ + QVA CLVDGC +DLS CRDYHRRHKVCE HSKTP+V Sbjct: 80 KRARGANSGTQVAMCLVDGCNSDLSTCRDYHRRHKVCELHSKTPQV 125 >ref|XP_007209206.1| hypothetical protein PRUPE_ppa006611mg [Prunus persica] gi|462404941|gb|EMJ10405.1| hypothetical protein PRUPE_ppa006611mg [Prunus persica] Length = 403 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = +2 Query: 215 KRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSKTPKV 352 KR++A + Q +CLVDGC +DLS+CRDYHRRHKVCE HSKTP+V Sbjct: 80 KRSRAAYSGSQTVSCLVDGCNSDLSVCRDYHRRHKVCELHSKTPQV 125 >ref|XP_002514891.1| conserved hypothetical protein [Ricinus communis] gi|223545942|gb|EEF47445.1| conserved hypothetical protein [Ricinus communis] Length = 404 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/46 (69%), Positives = 36/46 (78%) Frame = +2 Query: 215 KRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSKTPKV 352 KR + AN + +CLVDGC +DLS CRDYHRRHKVCE HSKTPKV Sbjct: 78 KRVRTPANGTHIPSCLVDGCASDLSKCRDYHRRHKVCELHSKTPKV 123 >gb|EXB25256.1| Squamosa promoter-binding-like protein 13 [Morus notabilis] Length = 399 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/46 (69%), Positives = 36/46 (78%) Frame = +2 Query: 215 KRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSKTPKV 352 KR++ N Q +CLVDGC ADLS CRDYHRRHKVCE HSKTP+V Sbjct: 81 KRSRGSYNGSQAVSCLVDGCNADLSNCRDYHRRHKVCELHSKTPQV 126 >ref|XP_004503742.1| PREDICTED: squamosa promoter-binding-like protein 13A-like isoform X1 [Cicer arietinum] gi|502139372|ref|XP_004503743.1| PREDICTED: squamosa promoter-binding-like protein 13A-like isoform X2 [Cicer arietinum] Length = 399 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +2 Query: 215 KRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSKTPKV 352 KRA+A+ N Q+ CLVDGC ADLS CRDYHRRHKVCE HSKT +V Sbjct: 91 KRARAINNGTQIVACLVDGCQADLSNCRDYHRRHKVCELHSKTAQV 136 >gb|ADL36824.1| SPL domain class transcription factor [Malus domestica] Length = 415 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = +2 Query: 215 KRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSKTPKV 352 KR++A + Q+ +CLVDGC +DLS CRDYHRRHKVCE HSKTP+V Sbjct: 83 KRSRAAYSGSQMVSCLVDGCNSDLSTCRDYHRRHKVCELHSKTPQV 128 >ref|XP_003532399.2| PREDICTED: squamosa promoter-binding-like protein 13B-like isoform X1 [Glycine max] Length = 422 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = +2 Query: 215 KRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSKTPKV 352 KRA++L+N Q +CLVDGC +DLS CRDYHRRHKVCE HSKT +V Sbjct: 110 KRARSLSNGTQTVSCLVDGCHSDLSNCRDYHRRHKVCEVHSKTAQV 155 >ref|XP_007224806.1| hypothetical protein PRUPE_ppa023657mg [Prunus persica] gi|462421742|gb|EMJ26005.1| hypothetical protein PRUPE_ppa023657mg [Prunus persica] Length = 300 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = +2 Query: 215 KRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSKTPKV 352 KR + N Q+A+CLVDGC++DLS CRDYHRRHKVCE HSKT KV Sbjct: 11 KRPRRTNNGAQIASCLVDGCSSDLSECRDYHRRHKVCELHSKTSKV 56 >ref|XP_006584701.1| PREDICTED: squamosa promoter-binding-like protein 13B-like isoform X2 [Glycine max] gi|571469397|ref|XP_006584702.1| PREDICTED: squamosa promoter-binding-like protein 13B-like isoform X3 [Glycine max] gi|571469399|ref|XP_006584703.1| PREDICTED: squamosa promoter-binding-like protein 13B-like isoform X4 [Glycine max] gi|571469401|ref|XP_006584704.1| PREDICTED: squamosa promoter-binding-like protein 13B-like isoform X5 [Glycine max] Length = 396 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = +2 Query: 215 KRAKALANVGQVANCLVDGCTADLSLCRDYHRRHKVCEAHSKTPKV 352 KRA++L+N Q +CLVDGC +DLS CRDYHRRHKVCE HSKT +V Sbjct: 84 KRARSLSNGTQTVSCLVDGCHSDLSNCRDYHRRHKVCEVHSKTAQV 129