BLASTX nr result
ID: Mentha25_contig00019139
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00019139 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40484.1| hypothetical protein MIMGU_mgv1a004107mg [Mimulus... 57 3e-06 ref|XP_002313574.2| calcium-dependent/calmodulin-independent pro... 57 3e-06 ref|XP_006855638.1| hypothetical protein AMTR_s00044p00104590 [A... 56 6e-06 dbj|BAB16888.1| OsCDPK7 [Oryza sativa Japonica Group] gi|3834427... 55 8e-06 ref|XP_006652699.1| PREDICTED: calcium-dependent protein kinase ... 55 8e-06 gb|EPS61686.1| calcium dependent protein kinase 5, partial [Genl... 55 8e-06 ref|XP_004976604.1| PREDICTED: calcium-dependent protein kinase ... 55 8e-06 ref|XP_004953480.1| PREDICTED: calcium-dependent protein kinase ... 55 8e-06 gb|EMT18908.1| Calcium-dependent protein kinase 5 [Aegilops taus... 55 8e-06 gb|EMS52553.1| Calcium-dependent protein kinase 5 [Triticum urartu] 55 8e-06 ref|NP_001105307.1| Calcium-dependent protein kinase [Zea mays] ... 55 8e-06 gb|AFV30233.1| calcium-dependent protein kinase [Triticum aestivum] 55 8e-06 gb|AFR54115.1| calcium-dependent protein kinase 3-like protein, ... 55 8e-06 ref|XP_003580397.1| PREDICTED: calcium-dependent protein kinase ... 55 8e-06 dbj|BAJ93361.1| predicted protein [Hordeum vulgare subsp. vulgare] 55 8e-06 dbj|BAJ88672.1| predicted protein [Hordeum vulgare subsp. vulgare] 55 8e-06 dbj|BAJ89609.1| predicted protein [Hordeum vulgare subsp. vulgare] 55 8e-06 ref|XP_002446994.1| hypothetical protein SORBIDRAFT_06g026530 [S... 55 8e-06 gb|ACR37715.1| unknown [Zea mays] 55 8e-06 ref|NP_001170478.1| LOC100384476 [Zea mays] gi|226701022|gb|ACO7... 55 8e-06 >gb|EYU40484.1| hypothetical protein MIMGU_mgv1a004107mg [Mimulus guttatus] Length = 543 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP 227 VAMMTKGN G+GRRTMRNSLNISMRDAP Sbjct: 513 VAMMTKGNAGVGRRTMRNSLNISMRDAP 540 >ref|XP_002313574.2| calcium-dependent/calmodulin-independent protein kinase [Populus trichocarpa] gi|550331893|gb|EEE87529.2| calcium-dependent/calmodulin-independent protein kinase [Populus trichocarpa] Length = 536 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP*LLFQFNM 203 VAMM KGN GIGRRTMRNSLN+SMRDAP L+ NM Sbjct: 501 VAMMQKGNAGIGRRTMRNSLNMSMRDAPGALYLGNM 536 >ref|XP_006855638.1| hypothetical protein AMTR_s00044p00104590 [Amborella trichopoda] gi|548859425|gb|ERN17105.1| hypothetical protein AMTR_s00044p00104590 [Amborella trichopoda] Length = 564 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP 227 VAMM KGNGG+GRRTMRNSLN+SMRDAP Sbjct: 534 VAMMLKGNGGLGRRTMRNSLNVSMRDAP 561 >dbj|BAB16888.1| OsCDPK7 [Oryza sativa Japonica Group] gi|38344274|emb|CAE03753.2| OSJNBa0013K16.2 [Oryza sativa Japonica Group] gi|215692742|dbj|BAG88162.1| unnamed protein product [Oryza sativa Japonica Group] gi|218195438|gb|EEC77865.1| hypothetical protein OsI_17131 [Oryza sativa Indica Group] gi|315666561|gb|ADU55583.1| calcium-dependent protein kinase [synthetic construct] Length = 551 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP 227 VAMMTKGN G+GRRTMRNSLNISMRDAP Sbjct: 521 VAMMTKGNMGVGRRTMRNSLNISMRDAP 548 >ref|XP_006652699.1| PREDICTED: calcium-dependent protein kinase 5-like [Oryza brachyantha] Length = 515 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP 227 VAMMTKGN G+GRRTMRNSLNISMRDAP Sbjct: 485 VAMMTKGNMGVGRRTMRNSLNISMRDAP 512 >gb|EPS61686.1| calcium dependent protein kinase 5, partial [Genlisea aurea] Length = 479 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP 227 VAMMTKGN G+GRRTMRNSLN+SMRDAP Sbjct: 449 VAMMTKGNAGVGRRTMRNSLNMSMRDAP 476 >ref|XP_004976604.1| PREDICTED: calcium-dependent protein kinase 4-like [Setaria italica] Length = 556 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP 227 VAMMTKGN G+GRRTMRNSLNISMRDAP Sbjct: 526 VAMMTKGNMGVGRRTMRNSLNISMRDAP 553 >ref|XP_004953480.1| PREDICTED: calcium-dependent protein kinase 5-like [Setaria italica] Length = 559 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP 227 VAMMTKGN G+GRRTMRNSLNISMRDAP Sbjct: 529 VAMMTKGNMGVGRRTMRNSLNISMRDAP 556 >gb|EMT18908.1| Calcium-dependent protein kinase 5 [Aegilops tauschii] Length = 706 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP 227 VAMMTKGN G+GRRTMRNSLNISMRDAP Sbjct: 676 VAMMTKGNMGVGRRTMRNSLNISMRDAP 703 >gb|EMS52553.1| Calcium-dependent protein kinase 5 [Triticum urartu] Length = 468 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP 227 VAMMTKGN G+GRRTMRNSLNISMRDAP Sbjct: 438 VAMMTKGNMGVGRRTMRNSLNISMRDAP 465 >ref|NP_001105307.1| Calcium-dependent protein kinase [Zea mays] gi|1504052|dbj|BAA13232.1| calcium-dependent protein kinase [Zea mays] Length = 554 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP 227 VAMMTKGN G+GRRTMRNSLNISMRDAP Sbjct: 524 VAMMTKGNMGVGRRTMRNSLNISMRDAP 551 >gb|AFV30233.1| calcium-dependent protein kinase [Triticum aestivum] Length = 559 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP 227 VAMMTKGN G+GRRTMRNSLNISMRDAP Sbjct: 529 VAMMTKGNMGVGRRTMRNSLNISMRDAP 556 >gb|AFR54115.1| calcium-dependent protein kinase 3-like protein, partial [Triticum aestivum] Length = 272 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP 227 VAMMTKGN G+GRRTMRNSLNISMRDAP Sbjct: 242 VAMMTKGNMGVGRRTMRNSLNISMRDAP 269 >ref|XP_003580397.1| PREDICTED: calcium-dependent protein kinase 4-like [Brachypodium distachyon] Length = 561 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP 227 VAMMTKGN G+GRRTMRNSLNISMRDAP Sbjct: 531 VAMMTKGNMGVGRRTMRNSLNISMRDAP 558 >dbj|BAJ93361.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 557 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP 227 VAMMTKGN G+GRRTMRNSLNISMRDAP Sbjct: 527 VAMMTKGNMGVGRRTMRNSLNISMRDAP 554 >dbj|BAJ88672.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 557 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP 227 VAMMTKGN G+GRRTMRNSLNISMRDAP Sbjct: 527 VAMMTKGNMGVGRRTMRNSLNISMRDAP 554 >dbj|BAJ89609.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 490 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP 227 VAMMTKGN G+GRRTMRNSLNISMRDAP Sbjct: 460 VAMMTKGNMGVGRRTMRNSLNISMRDAP 487 >ref|XP_002446994.1| hypothetical protein SORBIDRAFT_06g026530 [Sorghum bicolor] gi|241938177|gb|EES11322.1| hypothetical protein SORBIDRAFT_06g026530 [Sorghum bicolor] Length = 555 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP 227 VAMMTKGN G+GRRTMRNSLNISMRDAP Sbjct: 525 VAMMTKGNMGVGRRTMRNSLNISMRDAP 552 >gb|ACR37715.1| unknown [Zea mays] Length = 226 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP 227 VAMMTKGN G+GRRTMRNSLNISMRDAP Sbjct: 196 VAMMTKGNMGVGRRTMRNSLNISMRDAP 223 >ref|NP_001170478.1| LOC100384476 [Zea mays] gi|226701022|gb|ACO72987.1| CDPK protein [Zea mays] gi|413919147|gb|AFW59079.1| putative calcium-dependent protein kinase family protein [Zea mays] Length = 556 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 310 VAMMTKGNGGIGRRTMRNSLNISMRDAP 227 VAMMTKGN G+GRRTMRNSLNISMRDAP Sbjct: 526 VAMMTKGNMGVGRRTMRNSLNISMRDAP 553