BLASTX nr result
ID: Mentha25_contig00019001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00019001 (428 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007215866.1| hypothetical protein PRUPE_ppa010481mg [Prun... 55 8e-06 ref|XP_002283026.1| PREDICTED: reticulon-like protein B8 isoform... 55 1e-05 >ref|XP_007215866.1| hypothetical protein PRUPE_ppa010481mg [Prunus persica] gi|462412016|gb|EMJ17065.1| hypothetical protein PRUPE_ppa010481mg [Prunus persica] Length = 248 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = -1 Query: 428 DQIDSFVYKLLGQVQHNYRKLDDGVLSRLPRASSFKKWGRKD 303 DQ+D+F Y++LGQ+QHNYRKLD GVLSR+P+ W + D Sbjct: 209 DQVDNFAYQVLGQLQHNYRKLDTGVLSRIPKGK--VNWKKHD 248 >ref|XP_002283026.1| PREDICTED: reticulon-like protein B8 isoform 3 [Vitis vinifera] gi|225446771|ref|XP_002283019.1| PREDICTED: reticulon-like protein B8 isoform 2 [Vitis vinifera] gi|225446773|ref|XP_002283015.1| PREDICTED: reticulon-like protein B8 isoform 1 [Vitis vinifera] gi|302143506|emb|CBI22067.3| unnamed protein product [Vitis vinifera] Length = 248 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = -1 Query: 428 DQIDSFVYKLLGQVQHNYRKLDDGVLSRLPRAS 330 DQ+D FVY++LGQ+QHNYRKLD G LS++P+ S Sbjct: 209 DQVDGFVYQVLGQLQHNYRKLDSGFLSKIPKGS 241