BLASTX nr result
ID: Mentha25_contig00018922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00018922 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20849.3| unnamed protein product [Vitis vinifera] 82 1e-13 ref|XP_002283826.1| PREDICTED: uncharacterized protein LOC100250... 82 1e-13 ref|XP_006450693.1| hypothetical protein CICLE_v10007340mg [Citr... 80 4e-13 ref|XP_004291180.1| PREDICTED: uncharacterized protein LOC101302... 80 4e-13 gb|EXB59790.1| hypothetical protein L484_010901 [Morus notabilis] 79 9e-13 ref|XP_006359749.1| PREDICTED: uncharacterized protein LOC102592... 79 9e-13 ref|XP_007225376.1| hypothetical protein PRUPE_ppa000805mg [Prun... 79 9e-13 ref|XP_004245164.1| PREDICTED: uncharacterized protein LOC101253... 79 9e-13 ref|XP_004148389.1| PREDICTED: uncharacterized protein LOC101217... 79 9e-13 ref|XP_002516505.1| conserved hypothetical protein [Ricinus comm... 77 2e-12 ref|XP_002309542.1| hypothetical protein POPTR_0006s25460g [Popu... 77 2e-12 ref|XP_007012134.1| Uncharacterized protein isoform 1 [Theobroma... 77 3e-12 ref|XP_006408799.1| hypothetical protein EUTSA_v10001895mg [Eutr... 77 3e-12 ref|XP_006293617.1| hypothetical protein CARUB_v10022569mg [Caps... 77 3e-12 ref|XP_002880708.1| hypothetical protein ARALYDRAFT_481432 [Arab... 77 3e-12 ref|NP_180151.3| uncharacterized protein [Arabidopsis thaliana] ... 77 3e-12 gb|AAC42250.1| unknown protein [Arabidopsis thaliana] 77 3e-12 ref|XP_007013067.1| Uncharacterized protein isoform 3 [Theobroma... 76 4e-12 ref|XP_007013066.1| Uncharacterized protein isoform 2 [Theobroma... 76 4e-12 ref|XP_007013065.1| Uncharacterized protein isoform 1 [Theobroma... 76 4e-12 >emb|CBI20849.3| unnamed protein product [Vitis vinifera] Length = 1002 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSGQW+STEPNTLLRVLCYRNDEAAS+FLKKTYNLPKKL Sbjct: 964 TSGQWNSTEPNTLLRVLCYRNDEAASKFLKKTYNLPKKL 1002 >ref|XP_002283826.1| PREDICTED: uncharacterized protein LOC100250865 [Vitis vinifera] Length = 985 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSGQW+STEPNTLLRVLCYRNDEAAS+FLKKTYNLPKKL Sbjct: 947 TSGQWNSTEPNTLLRVLCYRNDEAASKFLKKTYNLPKKL 985 >ref|XP_006450693.1| hypothetical protein CICLE_v10007340mg [Citrus clementina] gi|568844316|ref|XP_006476035.1| PREDICTED: uncharacterized protein LOC102607730 [Citrus sinensis] gi|557553919|gb|ESR63933.1| hypothetical protein CICLE_v10007340mg [Citrus clementina] Length = 990 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSGQW+ TEPNTLLRVLCYRNDEAA+RFLKKTYNLPKKL Sbjct: 952 TSGQWNPTEPNTLLRVLCYRNDEAATRFLKKTYNLPKKL 990 >ref|XP_004291180.1| PREDICTED: uncharacterized protein LOC101302034 [Fragaria vesca subsp. vesca] Length = 989 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSGQW+ TEPNTLLRVLCYRNDEAAS+FLKKTYNLPKKL Sbjct: 951 TSGQWNPTEPNTLLRVLCYRNDEAASKFLKKTYNLPKKL 989 >gb|EXB59790.1| hypothetical protein L484_010901 [Morus notabilis] Length = 962 Score = 78.6 bits (192), Expect = 9e-13 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSGQW+ TEPNTLLRVLCYRNDEAA++FLKKTYNLPKKL Sbjct: 924 TSGQWNPTEPNTLLRVLCYRNDEAAAKFLKKTYNLPKKL 962 >ref|XP_006359749.1| PREDICTED: uncharacterized protein LOC102592170 [Solanum tuberosum] Length = 1000 Score = 78.6 bits (192), Expect = 9e-13 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSGQW+ TEPNTLLRVLCYRND+AAS+FLKKTYNLPKKL Sbjct: 962 TSGQWNPTEPNTLLRVLCYRNDDAASKFLKKTYNLPKKL 1000 >ref|XP_007225376.1| hypothetical protein PRUPE_ppa000805mg [Prunus persica] gi|462422312|gb|EMJ26575.1| hypothetical protein PRUPE_ppa000805mg [Prunus persica] Length = 998 Score = 78.6 bits (192), Expect = 9e-13 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSGQW+ TEPNTLLRVLCYRNDEAA++FLKKTYNLPKKL Sbjct: 960 TSGQWNPTEPNTLLRVLCYRNDEAATKFLKKTYNLPKKL 998 >ref|XP_004245164.1| PREDICTED: uncharacterized protein LOC101253812 [Solanum lycopersicum] Length = 998 Score = 78.6 bits (192), Expect = 9e-13 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSGQW+ TEPNTLLRVLCYRND+AAS+FLKKTYNLPKKL Sbjct: 960 TSGQWNPTEPNTLLRVLCYRNDDAASKFLKKTYNLPKKL 998 >ref|XP_004148389.1| PREDICTED: uncharacterized protein LOC101217303 [Cucumis sativus] Length = 992 Score = 78.6 bits (192), Expect = 9e-13 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSGQW+ TEPNTLLRVLCYRND+AAS+FLKKTYNLPKKL Sbjct: 954 TSGQWNPTEPNTLLRVLCYRNDDAASKFLKKTYNLPKKL 992 >ref|XP_002516505.1| conserved hypothetical protein [Ricinus communis] gi|223544325|gb|EEF45846.1| conserved hypothetical protein [Ricinus communis] Length = 949 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSG+W+ TEPNTLLRVLCYRNDE+AS+FLKKTYNLPKKL Sbjct: 911 TSGEWNPTEPNTLLRVLCYRNDESASKFLKKTYNLPKKL 949 >ref|XP_002309542.1| hypothetical protein POPTR_0006s25460g [Populus trichocarpa] gi|222855518|gb|EEE93065.1| hypothetical protein POPTR_0006s25460g [Populus trichocarpa] Length = 994 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSGQW+ T+PNTLLR+LCYRNDEAASR+LKKTYNLPKKL Sbjct: 956 TSGQWNPTDPNTLLRMLCYRNDEAASRYLKKTYNLPKKL 994 >ref|XP_007012134.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|590573486|ref|XP_007012135.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508782497|gb|EOY29753.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508782498|gb|EOY29754.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 997 Score = 77.0 bits (188), Expect = 3e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSGQW+ TEPNTLLRVLCYRND+ AS+FLKKTYNLPKKL Sbjct: 959 TSGQWNPTEPNTLLRVLCYRNDDTASKFLKKTYNLPKKL 997 >ref|XP_006408799.1| hypothetical protein EUTSA_v10001895mg [Eutrema salsugineum] gi|557109955|gb|ESQ50252.1| hypothetical protein EUTSA_v10001895mg [Eutrema salsugineum] Length = 995 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSGQW+ EPNTLLRVLCYRNDE+A+RFLKKTYNLPKKL Sbjct: 957 TSGQWNGMEPNTLLRVLCYRNDESATRFLKKTYNLPKKL 995 >ref|XP_006293617.1| hypothetical protein CARUB_v10022569mg [Capsella rubella] gi|482562325|gb|EOA26515.1| hypothetical protein CARUB_v10022569mg [Capsella rubella] Length = 991 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSGQW+ EPNTLLRVLCYRNDE+A+RFLKKTYNLPKKL Sbjct: 953 TSGQWNGMEPNTLLRVLCYRNDESATRFLKKTYNLPKKL 991 >ref|XP_002880708.1| hypothetical protein ARALYDRAFT_481432 [Arabidopsis lyrata subsp. lyrata] gi|297326547|gb|EFH56967.1| hypothetical protein ARALYDRAFT_481432 [Arabidopsis lyrata subsp. lyrata] Length = 996 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSGQW+ EPNTLLRVLCYRNDE+A+RFLKKTYNLPKKL Sbjct: 958 TSGQWNGMEPNTLLRVLCYRNDESATRFLKKTYNLPKKL 996 >ref|NP_180151.3| uncharacterized protein [Arabidopsis thaliana] gi|110737479|dbj|BAF00682.1| hypothetical protein [Arabidopsis thaliana] gi|330252660|gb|AEC07754.1| uncharacterized protein AT2G25800 [Arabidopsis thaliana] Length = 987 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSGQW+ EPNTLLRVLCYRNDE+A+RFLKKTYNLPKKL Sbjct: 949 TSGQWNGMEPNTLLRVLCYRNDESATRFLKKTYNLPKKL 987 >gb|AAC42250.1| unknown protein [Arabidopsis thaliana] Length = 993 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSGQW+ EPNTLLRVLCYRNDE+A+RFLKKTYNLPKKL Sbjct: 955 TSGQWNGMEPNTLLRVLCYRNDESATRFLKKTYNLPKKL 993 >ref|XP_007013067.1| Uncharacterized protein isoform 3 [Theobroma cacao] gi|508783430|gb|EOY30686.1| Uncharacterized protein isoform 3 [Theobroma cacao] Length = 981 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSGQWS TEPNTLLRVLCYR+DE A++FLKKTYNLPKKL Sbjct: 943 TSGQWSPTEPNTLLRVLCYRSDETAAKFLKKTYNLPKKL 981 >ref|XP_007013066.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508783429|gb|EOY30685.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 980 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSGQWS TEPNTLLRVLCYR+DE A++FLKKTYNLPKKL Sbjct: 942 TSGQWSPTEPNTLLRVLCYRSDETAAKFLKKTYNLPKKL 980 >ref|XP_007013065.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508783428|gb|EOY30684.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 993 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +1 Query: 4 TSGQWSSTEPNTLLRVLCYRNDEAASRFLKKTYNLPKKL 120 TSGQWS TEPNTLLRVLCYR+DE A++FLKKTYNLPKKL Sbjct: 955 TSGQWSPTEPNTLLRVLCYRSDETAAKFLKKTYNLPKKL 993