BLASTX nr result
ID: Mentha25_contig00018835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00018835 (330 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28840.1| hypothetical protein MIMGU_mgv1a002643mg [Mimulus... 65 1e-08 >gb|EYU28840.1| hypothetical protein MIMGU_mgv1a002643mg [Mimulus guttatus] Length = 651 Score = 64.7 bits (156), Expect = 1e-08 Identities = 38/69 (55%), Positives = 45/69 (65%), Gaps = 4/69 (5%) Frame = -1 Query: 330 GQVLNGMGRNVITNDSIVAVDHRGGSRISWYVGVGSLLVLGAFLGYVLGFIARARRN--- 160 GQV NG N+I GG ISWYV V S+LVLGAFLGYV+GF++R+RR+ Sbjct: 581 GQVFNGRA-NMIVAGGGGGGGGDGGVVISWYVKVASILVLGAFLGYVVGFVSRSRRDAAS 639 Query: 159 -AKWMAVKS 136 AKW AVKS Sbjct: 640 EAKWTAVKS 648