BLASTX nr result
ID: Mentha25_contig00018411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00018411 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17700.1| hypothetical protein MIMGU_mgv1a001718mg [Mimulus... 69 9e-10 >gb|EYU17700.1| hypothetical protein MIMGU_mgv1a001718mg [Mimulus guttatus] Length = 769 Score = 68.6 bits (166), Expect = 9e-10 Identities = 46/112 (41%), Positives = 60/112 (53%), Gaps = 8/112 (7%) Frame = +3 Query: 3 IQSSAPDVNHMDKSVVSKENR------TSCHWQPKS-SPXXXXXXXXXXXXXXDSVTLET 161 IQS+ PD D++ +SKENR +S HWQPKS S +SVT ET Sbjct: 511 IQSAGPDKIQTDRTFISKENRNFVGERSSSHWQPKSNSSNANNNQHVNRNAGTESVTTET 570 Query: 162 NRNPKKGNPQHKESGNFSQPQSQTDQSLIMKSNVADDSVSRRHQDF-DREKK 314 NR PKK +PQHK + +QP +KSNV ++S Q+F +REKK Sbjct: 571 NRFPKKDHPQHKAHVSQTQPGHHYAN---VKSNVTEESTLGNQQEFNNREKK 619