BLASTX nr result
ID: Mentha25_contig00018380
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00018380 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44750.1| hypothetical protein MIMGU_mgv1a003253mg [Mimulus... 56 5e-06 >gb|EYU44750.1| hypothetical protein MIMGU_mgv1a003253mg [Mimulus guttatus] Length = 597 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/52 (59%), Positives = 36/52 (69%), Gaps = 3/52 (5%) Frame = +3 Query: 180 MRSMQLSNCRGFDHSELAAAGFSSDPR--RRGGAAIRSSFW-GGGLDLRDAE 326 M S+QLSNCRGF+H AAGF S + RR AIRSSFW GGGL+L D + Sbjct: 1 MCSLQLSNCRGFNHQSTFAAGFPSAEKKLRRSNFAIRSSFWGGGGLNLYDGK 52