BLASTX nr result
ID: Mentha25_contig00018304
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00018304 (674 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22443.1| hypothetical protein MIMGU_mgv1a012337mg [Mimulus... 58 3e-06 >gb|EYU22443.1| hypothetical protein MIMGU_mgv1a012337mg [Mimulus guttatus] Length = 253 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/35 (71%), Positives = 30/35 (85%), Gaps = 3/35 (8%) Frame = -3 Query: 516 CSPKLEV--EYYDDLQPNSCNLGFPVQNQ-GTWFW 421 C PKLE+ E++DDLQPNSCNLGFP+Q+Q GTW W Sbjct: 217 CLPKLEMVEEFFDDLQPNSCNLGFPIQDQLGTWLW 251