BLASTX nr result
ID: Mentha25_contig00018161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00018161 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA53420.1| ORF, partial [Nicotiana tabacum] 57 3e-06 >gb|AAA53420.1| ORF, partial [Nicotiana tabacum] Length = 81 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +1 Query: 229 RLLSSSPTRFMVELDIQIPSAFDPFAEAKDSGAAG 333 R+ SS P ++MV++D+QIPSAFDPFAEAKDSGA G Sbjct: 22 RVRSSLPAKYMVDIDVQIPSAFDPFAEAKDSGAPG 56