BLASTX nr result
ID: Mentha25_contig00017660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00017660 (421 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22716.1| hypothetical protein MIMGU_mgv1a010259mg [Mimulus... 95 9e-18 gb|EYU22715.1| hypothetical protein MIMGU_mgv1a010259mg [Mimulus... 95 9e-18 gb|EYU22714.1| hypothetical protein MIMGU_mgv1a010259mg [Mimulus... 95 9e-18 gb|EPS65910.1| hypothetical protein M569_08867 [Genlisea aurea] 93 4e-17 ref|XP_006343477.1| PREDICTED: uncharacterized protein LOC102583... 86 5e-15 ref|XP_006343476.1| PREDICTED: uncharacterized protein LOC102583... 86 5e-15 gb|EXC32458.1| hypothetical protein L484_012625 [Morus notabilis] 84 2e-14 ref|XP_002325938.2| hypothetical protein POPTR_0019s10000g, part... 84 2e-14 ref|XP_002525504.1| conserved hypothetical protein [Ricinus comm... 82 6e-14 emb|CBI31246.3| unnamed protein product [Vitis vinifera] 82 1e-13 ref|XP_002274203.1| PREDICTED: uncharacterized protein LOC100241... 82 1e-13 ref|XP_006376179.1| hypothetical protein POPTR_0013s10560g [Popu... 79 7e-13 ref|XP_006283915.1| hypothetical protein CARUB_v10005034mg, part... 77 2e-12 ref|XP_007019905.1| Actin-binding LIM protein 1, putative [Theob... 77 3e-12 ref|NP_567407.1| uncharacterized protein [Arabidopsis thaliana] ... 76 6e-12 gb|AAM61139.1| unknown [Arabidopsis thaliana] 76 6e-12 emb|CAB41111.1| putative protein [Arabidopsis thaliana] gi|72680... 76 6e-12 ref|NP_849374.1| uncharacterized protein [Arabidopsis thaliana] ... 76 6e-12 ref|XP_004290241.1| PREDICTED: uncharacterized protein LOC101304... 75 7e-12 ref|XP_007201288.1| hypothetical protein PRUPE_ppa008608mg [Prun... 75 7e-12 >gb|EYU22716.1| hypothetical protein MIMGU_mgv1a010259mg [Mimulus guttatus] Length = 314 Score = 95.1 bits (235), Expect = 9e-18 Identities = 46/64 (71%), Positives = 53/64 (82%) Frame = -3 Query: 194 KSVVWWKMPLNYHYYFVFRMSPVWTVSVAAAFMGFVILGRSFYKMKKNKKKARGLQIKVA 15 +S+VWWKMP+++ Y VFRMSPVWTVSVAAA MGF+ILGR YKM KKK RGL+IKV Sbjct: 214 RSLVWWKMPIDFLKYCVFRMSPVWTVSVAAAVMGFLILGRRLYKM---KKKTRGLEIKVT 270 Query: 14 VDDK 3 VDDK Sbjct: 271 VDDK 274 >gb|EYU22715.1| hypothetical protein MIMGU_mgv1a010259mg [Mimulus guttatus] Length = 317 Score = 95.1 bits (235), Expect = 9e-18 Identities = 46/64 (71%), Positives = 53/64 (82%) Frame = -3 Query: 194 KSVVWWKMPLNYHYYFVFRMSPVWTVSVAAAFMGFVILGRSFYKMKKNKKKARGLQIKVA 15 +S+VWWKMP+++ Y VFRMSPVWTVSVAAA MGF+ILGR YKM KKK RGL+IKV Sbjct: 214 RSLVWWKMPIDFLKYCVFRMSPVWTVSVAAAVMGFLILGRRLYKM---KKKTRGLEIKVT 270 Query: 14 VDDK 3 VDDK Sbjct: 271 VDDK 274 >gb|EYU22714.1| hypothetical protein MIMGU_mgv1a010259mg [Mimulus guttatus] Length = 318 Score = 95.1 bits (235), Expect = 9e-18 Identities = 46/64 (71%), Positives = 53/64 (82%) Frame = -3 Query: 194 KSVVWWKMPLNYHYYFVFRMSPVWTVSVAAAFMGFVILGRSFYKMKKNKKKARGLQIKVA 15 +S+VWWKMP+++ Y VFRMSPVWTVSVAAA MGF+ILGR YKM KKK RGL+IKV Sbjct: 214 RSLVWWKMPIDFLKYCVFRMSPVWTVSVAAAVMGFLILGRRLYKM---KKKTRGLEIKVT 270 Query: 14 VDDK 3 VDDK Sbjct: 271 VDDK 274 >gb|EPS65910.1| hypothetical protein M569_08867 [Genlisea aurea] Length = 258 Score = 92.8 bits (229), Expect = 4e-17 Identities = 59/158 (37%), Positives = 77/158 (48%), Gaps = 19/158 (12%) Frame = -3 Query: 419 NPSWIDPAGLEEN-PSRYLNKESTDFWXXXXXXSFLVRNEM--------------NVQAD 285 NPSWIDP + E+ P R L+ +S +FW N N Sbjct: 60 NPSWIDPGLVPEDYPVRRLHNDSREFWSDSITERSEDLNSSVSDVKNDGKNEVNDNTTVG 119 Query: 284 EAELLGKVQAXXXXXXXXXXXXXXXEI----DKMKSVVWWKMPLNYHYYFVFRMSPVWTV 117 + + G++ I +K KS+VWWKMP+ + Y+VFRM+PVW Sbjct: 120 SSAIFGEMNEQSEVEKELAGEDGEDSIPKKKNKKKSIVWWKMPMEFLKYYVFRMNPVWIA 179 Query: 116 SVAAAFMGFVILGRSFYKMKKNKKKARGLQIKVAVDDK 3 SVAAA MGFVILGR ++M KKK R L I V V+DK Sbjct: 180 SVAAAAMGFVILGRKLHQM---KKKTRVLAINVTVNDK 214 >ref|XP_006343477.1| PREDICTED: uncharacterized protein LOC102583038 isoform X2 [Solanum tuberosum] Length = 332 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/67 (62%), Positives = 49/67 (73%) Frame = -3 Query: 203 DKMKSVVWWKMPLNYHYYFVFRMSPVWTVSVAAAFMGFVILGRSFYKMKKNKKKARGLQI 24 D+ SVVWWK+PL Y VFR+ P+W SVAAA MGFVILGR YKM KKK +GL++ Sbjct: 227 DQKSSVVWWKVPLELLKYCVFRVRPMWAFSVAAAVMGFVILGRRLYKM---KKKTKGLEL 283 Query: 23 KVAVDDK 3 KV VDDK Sbjct: 284 KVTVDDK 290 >ref|XP_006343476.1| PREDICTED: uncharacterized protein LOC102583038 isoform X1 [Solanum tuberosum] Length = 333 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/67 (62%), Positives = 49/67 (73%) Frame = -3 Query: 203 DKMKSVVWWKMPLNYHYYFVFRMSPVWTVSVAAAFMGFVILGRSFYKMKKNKKKARGLQI 24 D+ SVVWWK+PL Y VFR+ P+W SVAAA MGFVILGR YKM KKK +GL++ Sbjct: 227 DQKSSVVWWKVPLELLKYCVFRVRPMWAFSVAAAVMGFVILGRRLYKM---KKKTKGLEL 283 Query: 23 KVAVDDK 3 KV VDDK Sbjct: 284 KVTVDDK 290 >gb|EXC32458.1| hypothetical protein L484_012625 [Morus notabilis] Length = 278 Score = 84.3 bits (207), Expect = 2e-14 Identities = 60/163 (36%), Positives = 79/163 (48%), Gaps = 24/163 (14%) Frame = -3 Query: 419 NPSWIDP-------AGLEENPSRYLNKESTDFWXXXXXXSFLVRNEMNVQADEAELLGKV 261 NPSWIDP AG+ +P + + ++D + E V E E +G+V Sbjct: 78 NPSWIDPVPETRFVAGIHHHPGDFWSDSASDRSDDRKLSDSEAKKE--VSPAEFEGIGEV 135 Query: 260 QAXXXXXXXXXXXXXXXE---------IDKMKS--------VVWWKMPLNYHYYFVFRMS 132 QA E I+++K VVWWK+PL Y FR+S Sbjct: 136 QALNLEEGNNNSISIVEESADAKESGEIEEVKKKSEGEKRMVVWWKVPLEVLKYCAFRVS 195 Query: 131 PVWTVSVAAAFMGFVILGRSFYKMKKNKKKARGLQIKVAVDDK 3 PVWT SVAAA +G VILGR YKM K+K + LQ+KV +DDK Sbjct: 196 PVWTFSVAAAMLGIVILGRRLYKM---KRKTQSLQLKVTMDDK 235 >ref|XP_002325938.2| hypothetical protein POPTR_0019s10000g, partial [Populus trichocarpa] gi|550317176|gb|EEF00320.2| hypothetical protein POPTR_0019s10000g, partial [Populus trichocarpa] Length = 318 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/67 (59%), Positives = 50/67 (74%) Frame = -3 Query: 203 DKMKSVVWWKMPLNYHYYFVFRMSPVWTVSVAAAFMGFVILGRSFYKMKKNKKKARGLQI 24 +K K VVWWK+P Y VFR++PVW+VS+AAA MGFVILGR YKM ++K + LQ+ Sbjct: 224 EKRKVVVWWKVPFEVLRYCVFRLNPVWSVSMAAAVMGFVILGRRLYKM---RRKTKSLQL 280 Query: 23 KVAVDDK 3 KV VDDK Sbjct: 281 KVTVDDK 287 >ref|XP_002525504.1| conserved hypothetical protein [Ricinus communis] gi|223535183|gb|EEF36862.1| conserved hypothetical protein [Ricinus communis] Length = 325 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/67 (59%), Positives = 48/67 (71%) Frame = -3 Query: 203 DKMKSVVWWKMPLNYHYYFVFRMSPVWTVSVAAAFMGFVILGRSFYKMKKNKKKARGLQI 24 ++ + VVWWK+P Y VFR+SPVWT S+AAA MGFVILGR YKM K+K R L + Sbjct: 219 EEKRKVVWWKVPFELLRYCVFRISPVWTFSMAAAVMGFVILGRRLYKM---KRKTRSLPL 275 Query: 23 KVAVDDK 3 KV VDDK Sbjct: 276 KVTVDDK 282 >emb|CBI31246.3| unnamed protein product [Vitis vinifera] Length = 132 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/64 (59%), Positives = 48/64 (75%) Frame = -3 Query: 194 KSVVWWKMPLNYHYYFVFRMSPVWTVSVAAAFMGFVILGRSFYKMKKNKKKARGLQIKVA 15 + VVWWK+PL + Y FR+SPVW+ SVAAA +G VILGR Y+M K+K+R LQ+KV Sbjct: 29 RRVVWWKVPLEFFRYCAFRVSPVWSFSVAAAILGIVILGRRLYRM---KRKSRSLQLKVT 85 Query: 14 VDDK 3 VDDK Sbjct: 86 VDDK 89 >ref|XP_002274203.1| PREDICTED: uncharacterized protein LOC100241424 [Vitis vinifera] Length = 415 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/64 (59%), Positives = 48/64 (75%) Frame = -3 Query: 194 KSVVWWKMPLNYHYYFVFRMSPVWTVSVAAAFMGFVILGRSFYKMKKNKKKARGLQIKVA 15 + VVWWK+PL + Y FR+SPVW+ SVAAA +G VILGR Y+M K+K+R LQ+KV Sbjct: 312 RRVVWWKVPLEFFRYCAFRVSPVWSFSVAAAILGIVILGRRLYRM---KRKSRSLQLKVT 368 Query: 14 VDDK 3 VDDK Sbjct: 369 VDDK 372 >ref|XP_006376179.1| hypothetical protein POPTR_0013s10560g [Populus trichocarpa] gi|550325449|gb|ERP53976.1| hypothetical protein POPTR_0013s10560g [Populus trichocarpa] Length = 342 Score = 79.0 bits (193), Expect = 7e-13 Identities = 40/64 (62%), Positives = 46/64 (71%) Frame = -3 Query: 194 KSVVWWKMPLNYHYYFVFRMSPVWTVSVAAAFMGFVILGRSFYKMKKNKKKARGLQIKVA 15 + VV WK+P Y VFR SPVW+VSVAAA MGFVILGR YKM K+K + LQ+KV Sbjct: 246 RKVVLWKVPFEMLRYCVFRFSPVWSVSVAAAVMGFVILGRRLYKM---KRKTKSLQLKVT 302 Query: 14 VDDK 3 VDDK Sbjct: 303 VDDK 306 >ref|XP_006283915.1| hypothetical protein CARUB_v10005034mg, partial [Capsella rubella] gi|482552620|gb|EOA16813.1| hypothetical protein CARUB_v10005034mg, partial [Capsella rubella] Length = 383 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/64 (54%), Positives = 48/64 (75%) Frame = -3 Query: 194 KSVVWWKMPLNYHYYFVFRMSPVWTVSVAAAFMGFVILGRSFYKMKKNKKKARGLQIKVA 15 K VWWK+P+ Y VF+++P+W+ S+AAAF+GFV+LGR Y M KKK+R LQ+KV Sbjct: 281 KGFVWWKIPIEVLKYCVFKVNPIWSFSMAAAFVGFVMLGRRLYNM---KKKSRTLQLKVL 337 Query: 14 VDDK 3 +DDK Sbjct: 338 LDDK 341 >ref|XP_007019905.1| Actin-binding LIM protein 1, putative [Theobroma cacao] gi|508725233|gb|EOY17130.1| Actin-binding LIM protein 1, putative [Theobroma cacao] Length = 357 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/64 (57%), Positives = 45/64 (70%) Frame = -3 Query: 194 KSVVWWKMPLNYHYYFVFRMSPVWTVSVAAAFMGFVILGRSFYKMKKNKKKARGLQIKVA 15 K VVWWK+P Y VF++SPVW+ SVAAA MGF ILG YKM K+K+R L +KV Sbjct: 254 KRVVWWKVPFELLRYCVFKVSPVWSFSVAAAVMGFAILGHRLYKM---KRKSRNLPLKVT 310 Query: 14 VDDK 3 +DDK Sbjct: 311 MDDK 314 >ref|NP_567407.1| uncharacterized protein [Arabidopsis thaliana] gi|51968944|dbj|BAD43164.1| unknown protein [Arabidopsis thaliana] gi|51970240|dbj|BAD43812.1| unknown protein [Arabidopsis thaliana] gi|332657890|gb|AEE83290.1| uncharacterized protein AT4G13530 [Arabidopsis thaliana] Length = 270 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/64 (53%), Positives = 47/64 (73%) Frame = -3 Query: 194 KSVVWWKMPLNYHYYFVFRMSPVWTVSVAAAFMGFVILGRSFYKMKKNKKKARGLQIKVA 15 K VWWK+P+ Y V +++P+W++S+AAAF+GFV+LGR Y M KKK R LQ+KV Sbjct: 169 KGFVWWKIPIEVLKYCVLKINPIWSLSMAAAFVGFVMLGRRLYNM---KKKTRSLQLKVL 225 Query: 14 VDDK 3 +DDK Sbjct: 226 LDDK 229 >gb|AAM61139.1| unknown [Arabidopsis thaliana] Length = 270 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/64 (53%), Positives = 47/64 (73%) Frame = -3 Query: 194 KSVVWWKMPLNYHYYFVFRMSPVWTVSVAAAFMGFVILGRSFYKMKKNKKKARGLQIKVA 15 K VWWK+P+ Y V +++P+W++S+AAAF+GFV+LGR Y M KKK R LQ+KV Sbjct: 169 KGFVWWKIPIEVLKYCVLKINPIWSLSMAAAFVGFVMLGRRLYNM---KKKTRSLQLKVL 225 Query: 14 VDDK 3 +DDK Sbjct: 226 LDDK 229 >emb|CAB41111.1| putative protein [Arabidopsis thaliana] gi|7268056|emb|CAB78395.1| putative protein [Arabidopsis thaliana] Length = 263 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/64 (53%), Positives = 47/64 (73%) Frame = -3 Query: 194 KSVVWWKMPLNYHYYFVFRMSPVWTVSVAAAFMGFVILGRSFYKMKKNKKKARGLQIKVA 15 K VWWK+P+ Y V +++P+W++S+AAAF+GFV+LGR Y M KKK R LQ+KV Sbjct: 169 KGFVWWKIPIEVLKYCVLKINPIWSLSMAAAFVGFVMLGRRLYNM---KKKTRSLQLKVL 225 Query: 14 VDDK 3 +DDK Sbjct: 226 LDDK 229 >ref|NP_849374.1| uncharacterized protein [Arabidopsis thaliana] gi|18389284|gb|AAL67085.1| unknown protein [Arabidopsis thaliana] gi|21436199|gb|AAM51387.1| unknown protein [Arabidopsis thaliana] gi|332657889|gb|AEE83289.1| uncharacterized protein AT4G13530 [Arabidopsis thaliana] Length = 269 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/64 (53%), Positives = 47/64 (73%) Frame = -3 Query: 194 KSVVWWKMPLNYHYYFVFRMSPVWTVSVAAAFMGFVILGRSFYKMKKNKKKARGLQIKVA 15 K VWWK+P+ Y V +++P+W++S+AAAF+GFV+LGR Y M KKK R LQ+KV Sbjct: 169 KGFVWWKIPIEVLKYCVLKINPIWSLSMAAAFVGFVMLGRRLYNM---KKKTRSLQLKVL 225 Query: 14 VDDK 3 +DDK Sbjct: 226 LDDK 229 >ref|XP_004290241.1| PREDICTED: uncharacterized protein LOC101304633 [Fragaria vesca subsp. vesca] Length = 309 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/64 (54%), Positives = 48/64 (75%) Frame = -3 Query: 194 KSVVWWKMPLNYHYYFVFRMSPVWTVSVAAAFMGFVILGRSFYKMKKNKKKARGLQIKVA 15 + V+WWK+PL Y VF++SPVW+ SVAAA MG VILGR Y+M K++++ Q+KVA Sbjct: 206 RMVLWWKVPLEVLKYCVFKVSPVWSFSVAAAVMGLVILGRRLYRM---KRRSQSFQLKVA 262 Query: 14 VDDK 3 +DDK Sbjct: 263 LDDK 266 >ref|XP_007201288.1| hypothetical protein PRUPE_ppa008608mg [Prunus persica] gi|462396688|gb|EMJ02487.1| hypothetical protein PRUPE_ppa008608mg [Prunus persica] Length = 325 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/64 (54%), Positives = 47/64 (73%) Frame = -3 Query: 194 KSVVWWKMPLNYHYYFVFRMSPVWTVSVAAAFMGFVILGRSFYKMKKNKKKARGLQIKVA 15 ++++WWK+P Y VFR+SPVW+ SVAAA MG V LGR YKM K+K++ LQ+KV Sbjct: 222 RTILWWKVPFEVLKYCVFRVSPVWSFSVAAAVMGLVFLGRRLYKM---KRKSQTLQLKVT 278 Query: 14 VDDK 3 +DDK Sbjct: 279 LDDK 282