BLASTX nr result
ID: Mentha25_contig00017598
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00017598 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS68930.1| hypothetical protein TRIUR3_15755 [Triticum urartu] 58 2e-06 ref|XP_002302858.1| hypothetical protein POPTR_0002s21730g [Popu... 57 3e-06 dbj|BAJ85052.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 5e-06 >gb|EMS68930.1| hypothetical protein TRIUR3_15755 [Triticum urartu] Length = 548 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +3 Query: 3 VQERLNLSLKNSVQFHWQRVIRGRSYRHLLKQVGLK 110 VQ+RL L+L+ S+ F WQRVIRGRSYRHL+K+VG K Sbjct: 513 VQQRLELTLQGSISFSWQRVIRGRSYRHLMKEVGYK 548 >ref|XP_002302858.1| hypothetical protein POPTR_0002s21730g [Populus trichocarpa] gi|566159298|ref|XP_006386789.1| hypothetical protein POPTR_0002s21730g [Populus trichocarpa] gi|222844584|gb|EEE82131.1| hypothetical protein POPTR_0002s21730g [Populus trichocarpa] gi|550345541|gb|ERP64586.1| hypothetical protein POPTR_0002s21730g [Populus trichocarpa] Length = 567 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +3 Query: 3 VQERLNLSLKNSVQFHWQRVIRGRSYRHLLKQVGLK 110 VQER+ +SL+N +QF WQR+IRGRSYRHL+ QVG K Sbjct: 532 VQERMKMSLQNLLQFLWQRIIRGRSYRHLMLQVGYK 567 >dbj|BAJ85052.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 559 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = +3 Query: 3 VQERLNLSLKNSVQFHWQRVIRGRSYRHLLKQVGLK 110 VQ+RL L+++ S+ F WQRV+RGRSYRHL+K+VG K Sbjct: 524 VQQRLELTVQESISFSWQRVVRGRSYRHLMKEVGYK 559