BLASTX nr result
ID: Mentha25_contig00017532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00017532 (902 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268095.1| PREDICTED: rRNA-processing protein fcf2-like... 58 6e-06 emb|CBI26010.3| unnamed protein product [Vitis vinifera] 58 6e-06 ref|XP_002312762.1| hypothetical protein POPTR_0008s21130g [Popu... 57 1e-05 >ref|XP_002268095.1| PREDICTED: rRNA-processing protein fcf2-like isoform 1 [Vitis vinifera] gi|359477274|ref|XP_003631957.1| PREDICTED: rRNA-processing protein fcf2-like isoform 2 [Vitis vinifera] Length = 198 Score = 57.8 bits (138), Expect = 6e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +1 Query: 1 ADELLADTTFHQYRKRKVREIEDKNRPAGVDKW 99 ADELL++++F YRKRKVREIE++NRPAGVDKW Sbjct: 150 ADELLSNSSFADYRKRKVREIEEQNRPAGVDKW 182 >emb|CBI26010.3| unnamed protein product [Vitis vinifera] Length = 198 Score = 57.8 bits (138), Expect = 6e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +1 Query: 1 ADELLADTTFHQYRKRKVREIEDKNRPAGVDKW 99 ADELL++++F YRKRKVREIE++NRPAGVDKW Sbjct: 150 ADELLSNSSFADYRKRKVREIEEQNRPAGVDKW 182 >ref|XP_002312762.1| hypothetical protein POPTR_0008s21130g [Populus trichocarpa] gi|118488000|gb|ABK95821.1| unknown [Populus trichocarpa] gi|222852582|gb|EEE90129.1| hypothetical protein POPTR_0008s21130g [Populus trichocarpa] Length = 198 Score = 57.0 bits (136), Expect = 1e-05 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 1 ADELLADTTFHQYRKRKVREIEDKNRPAGVDKW 99 ADELL D TF YRKRKVREIE+KNRP G DKW Sbjct: 150 ADELLYDQTFRAYRKRKVREIEEKNRPGGNDKW 182