BLASTX nr result
ID: Mentha25_contig00017504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00017504 (362 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31274.1| hypothetical protein MIMGU_mgv1a000087mg [Mimulus... 61 1e-07 >gb|EYU31274.1| hypothetical protein MIMGU_mgv1a000087mg [Mimulus guttatus] Length = 1861 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = +2 Query: 2 MEVSEPSNAIEEEIQKSPTLKNLASPSSPTLQKTPEPDSSENP 130 +E+ EPS A+E+E S LKNL SPSSP+LQKTPEPDS+ENP Sbjct: 1804 IEMPEPSCALEDEAPLSKLLKNLPSPSSPSLQKTPEPDSAENP 1846