BLASTX nr result
ID: Mentha25_contig00017346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00017346 (434 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34959.1| hypothetical protein MIMGU_mgv1a001816mg [Mimulus... 59 9e-07 >gb|EYU34959.1| hypothetical protein MIMGU_mgv1a001816mg [Mimulus guttatus] Length = 755 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = -3 Query: 432 SRQMGQVSLKVNSSEHMEIALIALISVFRSLMKKRSYNNGGGKEPREIG 286 SR MGQV +++NSSEHMEIAL+A++S+ R+L +K+S NN E E G Sbjct: 707 SRNMGQVCVRMNSSEHMEIALVAVVSLLRALFRKKSNNNFSSSETTETG 755