BLASTX nr result
ID: Mentha25_contig00017137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00017137 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29061.1| hypothetical protein MIMGU_mgv1a015430mg [Mimulus... 85 1e-14 ref|NP_001053732.1| Os04g0595200 [Oryza sativa Japonica Group] g... 77 2e-12 ref|XP_007158235.1| hypothetical protein PHAVU_002G135400g [Phas... 76 6e-12 ref|XP_006652735.1| PREDICTED: MIP18 family protein At1g68310-li... 75 7e-12 ref|XP_004976666.1| PREDICTED: MIP18 family protein At1g68310-li... 75 9e-12 ref|XP_004976665.1| PREDICTED: MIP18 family protein At1g68310-li... 75 9e-12 gb|ACN36278.1| unknown [Zea mays] gi|414585649|tpg|DAA36220.1| T... 74 3e-11 ref|XP_002276610.1| PREDICTED: MIP18 family protein At1g68310-li... 73 5e-11 ref|XP_006352931.1| PREDICTED: MIP18 family protein At1g68310-li... 72 6e-11 gb|EPS70065.1| hypothetical protein M569_04694 [Genlisea aurea] 72 6e-11 ref|NP_001144185.1| uncharacterized protein LOC100277042 [Zea ma... 72 8e-11 ref|XP_006391152.1| hypothetical protein EUTSA_v10019265mg [Eutr... 72 1e-10 gb|ACF80547.1| unknown [Zea mays] gi|195609216|gb|ACG26438.1| hy... 72 1e-10 ref|XP_002448447.1| hypothetical protein SORBIDRAFT_06g027250 [S... 71 1e-10 ref|XP_006432681.1| hypothetical protein CICLE_v10002744mg [Citr... 71 2e-10 ref|XP_007206060.1| hypothetical protein PRUPE_ppa012667mg [Prun... 71 2e-10 ref|XP_004245976.1| PREDICTED: MIP18 family protein At1g68310-li... 71 2e-10 dbj|BAJ99417.1| predicted protein [Hordeum vulgare subsp. vulgar... 71 2e-10 gb|ACU24218.1| unknown [Glycine max] 71 2e-10 ref|NP_001239885.1| uncharacterized protein LOC100802864 [Glycin... 71 2e-10 >gb|EYU29061.1| hypothetical protein MIMGU_mgv1a015430mg [Mimulus guttatus] Length = 158 Score = 84.7 bits (208), Expect = 1e-14 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPDYVDEYAIETIDQLEIFEHIRDIK 306 MV+GLINANPVVYEKKERRTR++P VDEYA+E IDQLEIF+HIRDIK Sbjct: 1 MVSGLINANPVVYEKKERRTRSSPGDVDEYAVEQIDQLEIFDHIRDIK 48 >ref|NP_001053732.1| Os04g0595200 [Oryza sativa Japonica Group] gi|113565303|dbj|BAF15646.1| Os04g0595200 [Oryza sativa Japonica Group] Length = 158 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPDYVDEYAIETIDQLEIFEHIRDIK 306 MV GLINANPVVYEKKERR+R P+ DE A E IDQLEIF+HIRDIK Sbjct: 1 MVVGLINANPVVYEKKERRSRQAPETTDENAAEAIDQLEIFDHIRDIK 48 >ref|XP_007158235.1| hypothetical protein PHAVU_002G135400g [Phaseolus vulgaris] gi|561031650|gb|ESW30229.1| hypothetical protein PHAVU_002G135400g [Phaseolus vulgaris] Length = 159 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/49 (73%), Positives = 43/49 (87%), Gaps = 1/49 (2%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPDYV-DEYAIETIDQLEIFEHIRDIK 306 MV+GLINANP++YEKKERR+RT P + DEYA+E IDQ EIF+HIRDIK Sbjct: 1 MVSGLINANPIIYEKKERRSRTAPTALQDEYAVEPIDQQEIFDHIRDIK 49 >ref|XP_006652735.1| PREDICTED: MIP18 family protein At1g68310-like isoform X1 [Oryza brachyantha] gi|573940670|ref|XP_006652736.1| PREDICTED: MIP18 family protein At1g68310-like isoform X2 [Oryza brachyantha] Length = 158 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/48 (75%), Positives = 39/48 (81%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPDYVDEYAIETIDQLEIFEHIRDIK 306 MV GLINANPV+YEKKERR R P+ DE A E IDQLEIF+HIRDIK Sbjct: 1 MVVGLINANPVIYEKKERRIRQAPETTDENAAEPIDQLEIFDHIRDIK 48 >ref|XP_004976666.1| PREDICTED: MIP18 family protein At1g68310-like isoform X2 [Setaria italica] gi|514822898|ref|XP_004986109.1| PREDICTED: MIP18 family protein At1g68310-like [Setaria italica] Length = 158 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPDYVDEYAIETIDQLEIFEHIRDIK 306 MV GLINANPV++EKKERR R P+ DE A+E IDQLEIF+HIRDIK Sbjct: 1 MVMGLINANPVIHEKKERRVRQAPETTDENAVEPIDQLEIFDHIRDIK 48 >ref|XP_004976665.1| PREDICTED: MIP18 family protein At1g68310-like isoform X1 [Setaria italica] Length = 171 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPDYVDEYAIETIDQLEIFEHIRDIK 306 MV GLINANPV++EKKERR R P+ DE A+E IDQLEIF+HIRDIK Sbjct: 1 MVMGLINANPVIHEKKERRVRQAPETTDENAVEPIDQLEIFDHIRDIK 48 >gb|ACN36278.1| unknown [Zea mays] gi|414585649|tpg|DAA36220.1| TPA: hypothetical protein ZEAMMB73_124336 [Zea mays] Length = 158 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPDYVDEYAIETIDQLEIFEHIRDIK 306 M GLINANP+++EKKERR R P+ DE A+E+IDQLEIF+HIRDIK Sbjct: 1 MAMGLINANPIIHEKKERRIRQAPETTDENAVESIDQLEIFDHIRDIK 48 >ref|XP_002276610.1| PREDICTED: MIP18 family protein At1g68310-like [Vitis vinifera] Length = 158 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPDYVDEYAIETIDQLEIFEHIRDIK 306 MV+GLINANPV+Y+KKER+ R P DEYA+E +DQ EIF+HIRDIK Sbjct: 1 MVSGLINANPVIYQKKERQVRIAPCDSDEYAVEPVDQQEIFDHIRDIK 48 >ref|XP_006352931.1| PREDICTED: MIP18 family protein At1g68310-like [Solanum tuberosum] Length = 158 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/48 (75%), Positives = 40/48 (83%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPDYVDEYAIETIDQLEIFEHIRDIK 306 MV+ LINANPVVYEKKERR R + +DEYA E IDQLEIF+HIRDIK Sbjct: 1 MVSELINANPVVYEKKERRDRGSRAVLDEYAAEPIDQLEIFDHIRDIK 48 >gb|EPS70065.1| hypothetical protein M569_04694 [Genlisea aurea] Length = 166 Score = 72.4 bits (176), Expect = 6e-11 Identities = 38/54 (70%), Positives = 42/54 (77%), Gaps = 6/54 (11%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPDY-VDEYAIETIDQLEIFE-----HIRDIK 306 MV GLINANP+VYEKKERRTR P VDEYA+E IDQLE+F+ HIRDIK Sbjct: 1 MVAGLINANPIVYEKKERRTRIAPTADVDEYAVEAIDQLEVFDILPATHIRDIK 54 >ref|NP_001144185.1| uncharacterized protein LOC100277042 [Zea mays] gi|195638168|gb|ACG38552.1| hypothetical protein [Zea mays] Length = 158 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPDYVDEYAIETIDQLEIFEHIRDIK 306 M GLINANP+++EKKERR R P+ DE A E+IDQLEIF+HIRDIK Sbjct: 1 MAMGLINANPIIHEKKERRIRQAPETTDENAAESIDQLEIFDHIRDIK 48 >ref|XP_006391152.1| hypothetical protein EUTSA_v10019265mg [Eutrema salsugineum] gi|567124341|ref|XP_006391153.1| hypothetical protein EUTSA_v10019265mg [Eutrema salsugineum] gi|567124345|ref|XP_006391154.1| hypothetical protein EUTSA_v10019265mg [Eutrema salsugineum] gi|557087586|gb|ESQ28438.1| hypothetical protein EUTSA_v10019265mg [Eutrema salsugineum] gi|557087587|gb|ESQ28439.1| hypothetical protein EUTSA_v10019265mg [Eutrema salsugineum] gi|557087588|gb|ESQ28440.1| hypothetical protein EUTSA_v10019265mg [Eutrema salsugineum] Length = 158 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/48 (70%), Positives = 38/48 (79%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPDYVDEYAIETIDQLEIFEHIRDIK 306 MV+GLIN NP VYEKKERR RT DE++ E IDQLEIF+HIRDIK Sbjct: 1 MVSGLINENPTVYEKKERRVRTDSSNTDEHSAEPIDQLEIFDHIRDIK 48 >gb|ACF80547.1| unknown [Zea mays] gi|195609216|gb|ACG26438.1| hypothetical protein [Zea mays] gi|195643750|gb|ACG41343.1| hypothetical protein [Zea mays] gi|413919387|gb|AFW59319.1| hypothetical protein ZEAMMB73_301781 [Zea mays] Length = 158 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPDYVDEYAIETIDQLEIFEHIRDIK 306 M GLINANP+++EKKERR R P+ DE A E IDQLEIF+HIRDIK Sbjct: 1 MAMGLINANPIIHEKKERRARQAPETTDENAAEPIDQLEIFDHIRDIK 48 >ref|XP_002448447.1| hypothetical protein SORBIDRAFT_06g027250 [Sorghum bicolor] gi|241939630|gb|EES12775.1| hypothetical protein SORBIDRAFT_06g027250 [Sorghum bicolor] Length = 158 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPDYVDEYAIETIDQLEIFEHIRDIK 306 M GLINANP+++EKKERR R P+ DE A E IDQLEIF+HIRDIK Sbjct: 1 MAMGLINANPIIHEKKERRIRPAPETTDENAAEPIDQLEIFDHIRDIK 48 >ref|XP_006432681.1| hypothetical protein CICLE_v10002744mg [Citrus clementina] gi|568834773|ref|XP_006471477.1| PREDICTED: MIP18 family protein At1g68310-like isoform X1 [Citrus sinensis] gi|568834775|ref|XP_006471478.1| PREDICTED: MIP18 family protein At1g68310-like isoform X2 [Citrus sinensis] gi|557534803|gb|ESR45921.1| hypothetical protein CICLE_v10002744mg [Citrus clementina] Length = 159 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/49 (71%), Positives = 40/49 (81%), Gaps = 1/49 (2%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPDYV-DEYAIETIDQLEIFEHIRDIK 306 MV+GLINANPVVYEKKERR R+ V DEYA E IDQ E+F+H+RDIK Sbjct: 1 MVSGLINANPVVYEKKERRARSASSCVNDEYAAEQIDQQEVFDHVRDIK 49 >ref|XP_007206060.1| hypothetical protein PRUPE_ppa012667mg [Prunus persica] gi|462401702|gb|EMJ07259.1| hypothetical protein PRUPE_ppa012667mg [Prunus persica] Length = 159 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/49 (71%), Positives = 40/49 (81%), Gaps = 1/49 (2%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPD-YVDEYAIETIDQLEIFEHIRDIK 306 MV+ LINANPV+YEKKERR R+ P DEYA+E IDQ EIF+HIRDIK Sbjct: 1 MVSELINANPVIYEKKERRVRSVPTAAADEYAVEPIDQQEIFDHIRDIK 49 >ref|XP_004245976.1| PREDICTED: MIP18 family protein At1g68310-like [Solanum lycopersicum] Length = 158 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPDYVDEYAIETIDQLEIFEHIRDIK 306 MV+ LINANPVVY+KKERR R +DEYA E IDQLEIF+HIRDIK Sbjct: 1 MVSELINANPVVYKKKERRDRGARTVLDEYAAEPIDQLEIFDHIRDIK 48 >dbj|BAJ99417.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326510339|dbj|BAJ87386.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 209 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPDYVDEYAIETIDQLEIFEHIRDIK 306 +V LINANPV++EK+ERRTR P+ +DE A E IDQLEIF+HIRDIK Sbjct: 52 IVMELINANPVIHEKRERRTRQAPEDIDENATEAIDQLEIFDHIRDIK 99 >gb|ACU24218.1| unknown [Glycine max] Length = 153 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/49 (69%), Positives = 40/49 (81%), Gaps = 1/49 (2%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPDYV-DEYAIETIDQLEIFEHIRDIK 306 MV+ LINANP++YEKKERR RT P DEYA+E IDQ E+F+HIRDIK Sbjct: 1 MVSELINANPIIYEKKERRPRTAPSAPHDEYAVELIDQQEVFDHIRDIK 49 >ref|NP_001239885.1| uncharacterized protein LOC100802864 [Glycine max] gi|255637195|gb|ACU18928.1| unknown [Glycine max] Length = 159 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/49 (69%), Positives = 40/49 (81%), Gaps = 1/49 (2%) Frame = +1 Query: 163 MVTGLINANPVVYEKKERRTRTTPDYV-DEYAIETIDQLEIFEHIRDIK 306 MV+ LINANP++YEKKERR RT P DEYA+E IDQ E+F+HIRDIK Sbjct: 1 MVSELINANPIIYEKKERRPRTAPSAPHDEYAVELIDQQEVFDHIRDIK 49