BLASTX nr result
ID: Mentha25_contig00016645
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00016645 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007209304.1| hypothetical protein PRUPE_ppa007851mg [Prun... 55 8e-06 >ref|XP_007209304.1| hypothetical protein PRUPE_ppa007851mg [Prunus persica] gi|462405039|gb|EMJ10503.1| hypothetical protein PRUPE_ppa007851mg [Prunus persica] Length = 353 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/54 (53%), Positives = 35/54 (64%), Gaps = 3/54 (5%) Frame = -1 Query: 153 DEWGEKTXXXXXPTSKFSGPDPPIDDDEWGGSG---VELGNGSPVAAGEATVED 1 DEWGE+ P SK S DPP ++DEWGG G VE+GNGSP A EA +E+ Sbjct: 69 DEWGEEAAPEAEPASKVSESDPPQNEDEWGGGGDDVVEIGNGSP-AKAEAEIEE 121