BLASTX nr result
ID: Mentha25_contig00015939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00015939 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18659.1| hypothetical protein MIMGU_mgv1a026895mg [Mimulus... 62 6e-08 >gb|EYU18659.1| hypothetical protein MIMGU_mgv1a026895mg [Mimulus guttatus] Length = 224 Score = 62.4 bits (150), Expect = 6e-08 Identities = 33/46 (71%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = +2 Query: 173 FKKAAGLATPTSVLPT-TSAGAATEDWSEISDAVCFELKQAFEMID 307 FKK GL+TPTSVLPT +SA +TE+WSEIS V F+LKQAFEMID Sbjct: 47 FKKPNGLSTPTSVLPTASSAEISTEEWSEISADVYFDLKQAFEMID 92