BLASTX nr result
ID: Mentha25_contig00015542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00015542 (445 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMR83885.1| hypothetical protein BcDW1_7517 [Botryotinia fuck... 59 5e-07 ref|XP_001556292.1| hypothetical protein BC1G_04910 [Botryotinia... 59 5e-07 ref|XP_007296050.1| hypothetical protein MBM_08161 [Marssonina b... 58 1e-06 emb|CCF41137.1| hypothetical protein CH063_02522 [Colletotrichum... 57 3e-06 gb|EFQ31386.1| hypothetical protein GLRG_06530 [Colletotrichum g... 56 5e-06 ref|XP_007592940.1| hypothetical protein CFIO01_10523 [Colletotr... 55 8e-06 >gb|EMR83885.1| hypothetical protein BcDW1_7517 [Botryotinia fuckeliana BcDW1] Length = 101 Score = 59.3 bits (142), Expect = 5e-07 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +1 Query: 364 SSNTGKVKCIECDGYECCCIPIPCVVM 444 +S TGK KC+ECDGYECCCIPIPC VM Sbjct: 75 TSTTGKTKCLECDGYECCCIPIPCTVM 101 >ref|XP_001556292.1| hypothetical protein BC1G_04910 [Botryotinia fuckeliana B05.10] gi|347831386|emb|CCD47083.1| hypothetical protein BofuT4P30000018001 [Botryotinia fuckeliana T4] Length = 56 Score = 59.3 bits (142), Expect = 5e-07 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +1 Query: 364 SSNTGKVKCIECDGYECCCIPIPCVVM 444 +S TGK KC+ECDGYECCCIPIPC VM Sbjct: 30 TSTTGKTKCLECDGYECCCIPIPCTVM 56 >ref|XP_007296050.1| hypothetical protein MBM_08161 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406860903|gb|EKD13960.1| hypothetical protein MBM_08161 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 57 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = +1 Query: 373 TGKVKCIECDGYECCCIPIPCVVM 444 TGK KCIECDGYECCCIPIPC VM Sbjct: 34 TGKTKCIECDGYECCCIPIPCTVM 57 >emb|CCF41137.1| hypothetical protein CH063_02522 [Colletotrichum higginsianum] Length = 58 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/57 (45%), Positives = 29/57 (50%) Frame = +1 Query: 274 ASSLTSGQLLNYNXXXXXXXXXXXRAKEALSSNTGKVKCIECDGYECCCIPIPCVVM 444 A S L+N N + + GK KCIECDGYECCCIPIPC VM Sbjct: 2 ACGSASSGLVNRNGPGSAATSIIDNIVKPAEATGGKTKCIECDGYECCCIPIPCTVM 58 >gb|EFQ31386.1| hypothetical protein GLRG_06530 [Colletotrichum graminicola M1.001] Length = 58 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 376 GKVKCIECDGYECCCIPIPCVVM 444 GK KCIECDGYECCCIPIPC VM Sbjct: 36 GKTKCIECDGYECCCIPIPCTVM 58 >ref|XP_007592940.1| hypothetical protein CFIO01_10523 [Colletotrichum fioriniae PJ7] gi|588903291|gb|EXF83433.1| hypothetical protein CFIO01_10523 [Colletotrichum fioriniae PJ7] Length = 97 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/57 (43%), Positives = 29/57 (50%) Frame = +1 Query: 274 ASSLTSGQLLNYNXXXXXXXXXXXRAKEALSSNTGKVKCIECDGYECCCIPIPCVVM 444 A S L+N N + + GK KCIECDGYECCCIPIPC V+ Sbjct: 2 ACGTASSGLVNRNGPGSAATSIIDSIVKPAEATGGKTKCIECDGYECCCIPIPCTVI 58