BLASTX nr result
ID: Mentha25_contig00014796
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00014796 (829 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004235024.1| PREDICTED: two-component response regulator-... 67 6e-09 ref|XP_006578870.1| PREDICTED: two-component response regulator-... 67 1e-08 ref|XP_003523317.1| PREDICTED: two-component response regulator-... 67 1e-08 gb|EYU45316.1| hypothetical protein MIMGU_mgv1a004082mg [Mimulus... 66 1e-08 ref|XP_006347516.1| PREDICTED: two-component response regulator-... 66 2e-08 ref|XP_003528000.1| PREDICTED: two-component response regulator-... 65 2e-08 gb|EYU19697.1| hypothetical protein MIMGU_mgv1a003461mg [Mimulus... 64 5e-08 gb|EXB78384.1| Two-component response regulator-like protein [Mo... 64 7e-08 ref|XP_007039206.1| Pseudo-response regulator 5, putative isofor... 64 7e-08 ref|XP_007039205.1| Pseudo-response regulator 5, putative isofor... 64 7e-08 ref|XP_002321349.1| PSEUDO-RESPONSE REGULATOR 5 family protein [... 64 7e-08 ref|XP_007220220.1| hypothetical protein PRUPE_ppa002188mg [Prun... 64 9e-08 gb|ACU42265.2| pseudo response regulator 59 [Pisum sativum] 63 1e-07 gb|ACU42266.1| pseudo response regulator 59 [Pisum sativum] 63 1e-07 gb|ABV53464.1| pseudo-response regulator 5 [Castanea sativa] 63 1e-07 ref|XP_002524429.1| conserved hypothetical protein [Ricinus comm... 63 1e-07 ref|XP_002317715.2| hypothetical protein POPTR_0012s00600g [Popu... 63 2e-07 ref|XP_002318502.1| hypothetical protein POPTR_0012s00600g [Popu... 63 2e-07 ref|XP_004502762.1| PREDICTED: two-component response regulator-... 62 2e-07 ref|XP_004502761.1| PREDICTED: two-component response regulator-... 62 2e-07 >ref|XP_004235024.1| PREDICTED: two-component response regulator-like APRR5-like [Solanum lycopersicum] Length = 680 Score = 67.4 bits (163), Expect = 6e-09 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -2 Query: 129 SVRVAVAGAAGLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 S RVA A + GLKAWE+LKGR HN+DLILTEVDLPSISGYALL Sbjct: 81 SYRVA-AVSDGLKAWELLKGRPHNVDLILTEVDLPSISGYALL 122 >ref|XP_006578870.1| PREDICTED: two-component response regulator-like PRR95-like isoform X2 [Glycine max] Length = 691 Score = 66.6 bits (161), Expect = 1e-08 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -2 Query: 114 VAGAAGLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 VA GLKAWE+LKGR HN+DLILTEVDLPSISGYALL Sbjct: 76 VAVPDGLKAWELLKGRPHNVDLILTEVDLPSISGYALL 113 >ref|XP_003523317.1| PREDICTED: two-component response regulator-like PRR95-like isoform X1 [Glycine max] Length = 655 Score = 66.6 bits (161), Expect = 1e-08 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -2 Query: 114 VAGAAGLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 VA GLKAWE+LKGR HN+DLILTEVDLPSISGYALL Sbjct: 76 VAVPDGLKAWELLKGRPHNVDLILTEVDLPSISGYALL 113 >gb|EYU45316.1| hypothetical protein MIMGU_mgv1a004082mg [Mimulus guttatus] Length = 545 Score = 66.2 bits (160), Expect = 1e-08 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -2 Query: 129 SVRVAVAGAAGLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 S RVA A + GLKAWE+LKGR HNIDLILTEV+LPSISGYALL Sbjct: 66 SYRVA-AVSDGLKAWELLKGRPHNIDLILTEVELPSISGYALL 107 >ref|XP_006347516.1| PREDICTED: two-component response regulator-like APRR5-like [Solanum tuberosum] Length = 680 Score = 65.9 bits (159), Expect = 2e-08 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -2 Query: 129 SVRVAVAGAAGLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 S RVA A + GLKAWE+LKGR HN+DLILTEVDLPSISGYA L Sbjct: 81 SYRVA-AVSDGLKAWELLKGRPHNVDLILTEVDLPSISGYAFL 122 >ref|XP_003528000.1| PREDICTED: two-component response regulator-like PRR95-like [Glycine max] Length = 700 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 99 GLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 GLKAWE+LKGR HN+DLILTEVDLPS+SGYALL Sbjct: 82 GLKAWELLKGRPHNVDLILTEVDLPSVSGYALL 114 >gb|EYU19697.1| hypothetical protein MIMGU_mgv1a003461mg [Mimulus guttatus] Length = 583 Score = 64.3 bits (155), Expect = 5e-08 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -2 Query: 129 SVRVAVAGAAGLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 S +VA A + GLKAWE+LK RSHNIDLILTEV+LPSISGYALL Sbjct: 93 SYKVA-AVSDGLKAWEVLKERSHNIDLILTEVELPSISGYALL 134 >gb|EXB78384.1| Two-component response regulator-like protein [Morus notabilis] Length = 698 Score = 63.9 bits (154), Expect = 7e-08 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -2 Query: 129 SVRVAVAGAAGLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 S RVA A + GLKAWE+LKGR H++DLILTEVDLPSISG+ALL Sbjct: 85 SYRVA-AVSDGLKAWELLKGRPHDVDLILTEVDLPSISGFALL 126 >ref|XP_007039206.1| Pseudo-response regulator 5, putative isoform 2 [Theobroma cacao] gi|508776451|gb|EOY23707.1| Pseudo-response regulator 5, putative isoform 2 [Theobroma cacao] Length = 695 Score = 63.9 bits (154), Expect = 7e-08 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -2 Query: 129 SVRVAVAGAAGLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 S RVA A GLKAWE+LKG+ HNIDLILTEVDLPSISG+ALL Sbjct: 79 SYRVA-AVPDGLKAWEMLKGKPHNIDLILTEVDLPSISGFALL 120 >ref|XP_007039205.1| Pseudo-response regulator 5, putative isoform 1 [Theobroma cacao] gi|508776450|gb|EOY23706.1| Pseudo-response regulator 5, putative isoform 1 [Theobroma cacao] Length = 689 Score = 63.9 bits (154), Expect = 7e-08 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -2 Query: 129 SVRVAVAGAAGLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 S RVA A GLKAWE+LKG+ HNIDLILTEVDLPSISG+ALL Sbjct: 79 SYRVA-AVPDGLKAWEMLKGKPHNIDLILTEVDLPSISGFALL 120 >ref|XP_002321349.1| PSEUDO-RESPONSE REGULATOR 5 family protein [Populus trichocarpa] gi|222868345|gb|EEF05476.1| PSEUDO-RESPONSE REGULATOR 5 family protein [Populus trichocarpa] Length = 687 Score = 63.9 bits (154), Expect = 7e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -2 Query: 129 SVRVAVAGAAGLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 S + + GLKAWEILK R HNIDLILTEVDLPS+SGYALL Sbjct: 88 SYKAVATVSDGLKAWEILKERPHNIDLILTEVDLPSVSGYALL 130 >ref|XP_007220220.1| hypothetical protein PRUPE_ppa002188mg [Prunus persica] gi|462416682|gb|EMJ21419.1| hypothetical protein PRUPE_ppa002188mg [Prunus persica] Length = 703 Score = 63.5 bits (153), Expect = 9e-08 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -2 Query: 129 SVRVAVAGAAGLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 S RVA A GLKAWEILK R HNIDLILTE+DLPSISG+ALL Sbjct: 77 SYRVA-AVPDGLKAWEILKARPHNIDLILTEIDLPSISGFALL 118 >gb|ACU42265.2| pseudo response regulator 59 [Pisum sativum] Length = 494 Score = 63.2 bits (152), Expect = 1e-07 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -2 Query: 111 AGAAGLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 A A GLKAWEILKGR N DLILTEVDLPS+SGYALL Sbjct: 73 AVADGLKAWEILKGRPRNFDLILTEVDLPSVSGYALL 109 >gb|ACU42266.1| pseudo response regulator 59 [Pisum sativum] Length = 469 Score = 63.2 bits (152), Expect = 1e-07 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -2 Query: 111 AGAAGLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 A A GLKAWEILKGR N DLILTEVDLPS+SGYALL Sbjct: 48 AVADGLKAWEILKGRPRNFDLILTEVDLPSVSGYALL 84 >gb|ABV53464.1| pseudo-response regulator 5 [Castanea sativa] Length = 698 Score = 63.2 bits (152), Expect = 1e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 99 GLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 GLKAWEIL+GR HNIDLILTEVDLP+ISG+ALL Sbjct: 94 GLKAWEILRGRPHNIDLILTEVDLPAISGFALL 126 >ref|XP_002524429.1| conserved hypothetical protein [Ricinus communis] gi|223536313|gb|EEF37964.1| conserved hypothetical protein [Ricinus communis] Length = 667 Score = 63.2 bits (152), Expect = 1e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 99 GLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 GLKAWE+LKG+ HNIDLILTEV+LPSISGYALL Sbjct: 76 GLKAWEMLKGKPHNIDLILTEVELPSISGYALL 108 >ref|XP_002317715.2| hypothetical protein POPTR_0012s00600g [Populus trichocarpa] gi|550326080|gb|EEE95935.2| hypothetical protein POPTR_0012s00600g [Populus trichocarpa] Length = 569 Score = 62.8 bits (151), Expect = 2e-07 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -2 Query: 99 GLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 GLKAWEILKGR H IDLILTEVDLPSISGY LL Sbjct: 97 GLKAWEILKGRPHGIDLILTEVDLPSISGYPLL 129 >ref|XP_002318502.1| hypothetical protein POPTR_0012s00600g [Populus trichocarpa] gi|222859175|gb|EEE96722.1| hypothetical protein POPTR_0012s00600g [Populus trichocarpa] Length = 529 Score = 62.8 bits (151), Expect = 2e-07 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -2 Query: 99 GLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 GLKAWEILKGR H IDLILTEVDLPSISGY LL Sbjct: 97 GLKAWEILKGRPHGIDLILTEVDLPSISGYPLL 129 >ref|XP_004502762.1| PREDICTED: two-component response regulator-like APRR5-like isoform X3 [Cicer arietinum] Length = 398 Score = 62.4 bits (150), Expect = 2e-07 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -2 Query: 111 AGAAGLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 A A GLKAWEILKGR +IDLILTEVDLPSISGYALL Sbjct: 73 AVADGLKAWEILKGRPGSIDLILTEVDLPSISGYALL 109 >ref|XP_004502761.1| PREDICTED: two-component response regulator-like APRR5-like isoform X2 [Cicer arietinum] Length = 673 Score = 62.4 bits (150), Expect = 2e-07 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -2 Query: 111 AGAAGLKAWEILKGRSHNIDLILTEVDLPSISGYALL 1 A A GLKAWEILKGR +IDLILTEVDLPSISGYALL Sbjct: 73 AVADGLKAWEILKGRPGSIDLILTEVDLPSISGYALL 109