BLASTX nr result
ID: Mentha25_contig00014795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00014795 (330 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34910.1| hypothetical protein MIMGU_mgv1a001179mg [Mimulus... 62 1e-07 gb|EYU24289.1| hypothetical protein MIMGU_mgv1a024266mg [Mimulus... 62 1e-07 gb|EYU23583.1| hypothetical protein MIMGU_mgv1a001176mg [Mimulus... 62 1e-07 ref|XP_004965051.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 gb|EMT23944.1| hypothetical protein F775_16829 [Aegilops tauschii] 60 4e-07 ref|XP_007226779.1| hypothetical protein PRUPE_ppa018015mg [Prun... 60 4e-07 ref|XP_006342693.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 ref|XP_002268148.2| PREDICTED: uncharacterized protein LOC100250... 59 5e-07 ref|XP_006655943.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_006428089.1| hypothetical protein CICLE_v10027512mg [Citr... 59 9e-07 ref|XP_004498663.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_003588753.1| Pentatricopeptide repeat-containing protein ... 59 9e-07 gb|EYU20789.1| hypothetical protein MIMGU_mgv1a002968mg [Mimulus... 58 1e-06 gb|EXB96783.1| hypothetical protein L484_001891 [Morus notabilis] 58 1e-06 ref|XP_002308660.2| hypothetical protein POPTR_0006s26860g [Popu... 58 1e-06 gb|EPS69231.1| hypothetical protein M569_05535 [Genlisea aurea] 58 1e-06 ref|XP_004485987.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 ref|XP_007201172.1| hypothetical protein PRUPE_ppa003481mg [Prun... 58 1e-06 ref|XP_006658876.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_006651864.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 >gb|EYU34910.1| hypothetical protein MIMGU_mgv1a001179mg [Mimulus guttatus] Length = 872 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW 232 K V+ST+D+EIVVRD +RFHHF G+CSCKDYW Sbjct: 840 KCVSSTVDQEIVVRDASRFHHFRNGICSCKDYW 872 >gb|EYU24289.1| hypothetical protein MIMGU_mgv1a024266mg [Mimulus guttatus] Length = 872 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW 232 K V+ST+D+EIVVRD +RFHHF G+CSCKDYW Sbjct: 840 KCVSSTVDQEIVVRDASRFHHFRNGICSCKDYW 872 >gb|EYU23583.1| hypothetical protein MIMGU_mgv1a001176mg [Mimulus guttatus] Length = 872 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW 232 K V+ST+D+EIVVRD +RFHHF G+CSCKDYW Sbjct: 840 KCVSSTVDQEIVVRDASRFHHFRNGICSCKDYW 872 >ref|XP_004965051.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Setaria italica] Length = 601 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW 232 KFV+ D EIVVRDRNRFHHF G CSCKDYW Sbjct: 569 KFVSRVFDREIVVRDRNRFHHFRDGKCSCKDYW 601 >gb|EMT23944.1| hypothetical protein F775_16829 [Aegilops tauschii] Length = 797 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/87 (35%), Positives = 50/87 (57%), Gaps = 1/87 (1%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW*C*LFSHWTLLILAAN-CIGCKKYKIY 154 K ++ + +EI+VRD NRFHHF +G CSC DYW L S ++ N C+ K +++ Sbjct: 631 KVISKIVKQEIIVRDINRFHHFDKGTCSCGDYW---LASISRIICKKKNACLIWTKQRMF 687 Query: 153 TLRQNSG*EIIQVCN*NLIFQTKFSVP 73 R+N+G ++ V ++ Q+K P Sbjct: 688 FFRENAGGLLLDVLKRVVLAQSKVFAP 714 >ref|XP_007226779.1| hypothetical protein PRUPE_ppa018015mg [Prunus persica] gi|462423715|gb|EMJ27978.1| hypothetical protein PRUPE_ppa018015mg [Prunus persica] Length = 624 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW 232 K ++ D EI+VRDRNRFHHF RG CSCKDYW Sbjct: 592 KLISKVFDREIIVRDRNRFHHFKRGDCSCKDYW 624 >ref|XP_006342693.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum tuberosum] Length = 628 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW 232 KF++ D EI+VRDRNRFHHF G CSCKDYW Sbjct: 596 KFISKVYDREIIVRDRNRFHHFKGGECSCKDYW 628 >ref|XP_002268148.2| PREDICTED: uncharacterized protein LOC100250295 [Vitis vinifera] Length = 1130 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/39 (58%), Positives = 29/39 (74%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW*C*LFS 214 K ++ D EI+VRD NRFHHF +GLCSC+DYW C F+ Sbjct: 540 KMISKVFDREIIVRDCNRFHHFTQGLCSCRDYWECKYFA 578 >ref|XP_006655943.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Oryza brachyantha] Length = 598 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW 232 K V+ D EIVVRDRNRFHHF G CSCKDYW Sbjct: 566 KIVSRVFDREIVVRDRNRFHHFKDGTCSCKDYW 598 >ref|XP_006428089.1| hypothetical protein CICLE_v10027512mg [Citrus clementina] gi|568819548|ref|XP_006464311.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Citrus sinensis] gi|557530079|gb|ESR41329.1| hypothetical protein CICLE_v10027512mg [Citrus clementina] Length = 785 Score = 58.5 bits (140), Expect = 9e-07 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW 232 KF+ +D EIVVRD RFHHF +GLCSC+DYW Sbjct: 753 KFICKLVDREIVVRDATRFHHFKKGLCSCRDYW 785 >ref|XP_004498663.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cicer arietinum] Length = 609 Score = 58.5 bits (140), Expect = 9e-07 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW 232 KF++ + EIVVRDRNRFHHF GLCSC+D+W Sbjct: 577 KFISKVYNREIVVRDRNRFHHFKNGLCSCRDFW 609 >ref|XP_003588753.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355477801|gb|AES59004.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 600 Score = 58.5 bits (140), Expect = 9e-07 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW 232 KF++ + EIVVRDRNRFHHF GLCSC+D+W Sbjct: 568 KFISKVYNREIVVRDRNRFHHFKNGLCSCRDFW 600 >gb|EYU20789.1| hypothetical protein MIMGU_mgv1a002968mg [Mimulus guttatus] Length = 621 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW 232 K ++ D EIVVRDRNRFHHF GLCSC DYW Sbjct: 589 KLISMVYDREIVVRDRNRFHHFRGGLCSCNDYW 621 >gb|EXB96783.1| hypothetical protein L484_001891 [Morus notabilis] Length = 599 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW 232 KF++ + EIVVRDRNRFHHF GLCSCKD+W Sbjct: 567 KFISKIYNREIVVRDRNRFHHFMDGLCSCKDFW 599 >ref|XP_002308660.2| hypothetical protein POPTR_0006s26860g [Populus trichocarpa] gi|550337158|gb|EEE92183.2| hypothetical protein POPTR_0006s26860g [Populus trichocarpa] Length = 487 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW 232 KF++ + EIVVRDRNRFHHF GLCSC+D+W Sbjct: 455 KFISKIYNREIVVRDRNRFHHFKNGLCSCRDFW 487 >gb|EPS69231.1| hypothetical protein M569_05535 [Genlisea aurea] Length = 628 Score = 58.2 bits (139), Expect = 1e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW 232 K +++ D EI+VRDRNRFHHF RG+CSC D+W Sbjct: 596 KLISACYDREIIVRDRNRFHHFRRGVCSCNDFW 628 >ref|XP_004485987.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cicer arietinum] Length = 610 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW 232 K ++ D EIV+RDR+RFHHF GLCSCKDYW Sbjct: 578 KLISKVYDREIVIRDRSRFHHFRDGLCSCKDYW 610 >ref|XP_007201172.1| hypothetical protein PRUPE_ppa003481mg [Prunus persica] gi|462396572|gb|EMJ02371.1| hypothetical protein PRUPE_ppa003481mg [Prunus persica] Length = 571 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW 232 K ++ D EIV+RD NRFHHF +GLCSCKDYW Sbjct: 539 KMISKEFDREIVIRDCNRFHHFRQGLCSCKDYW 571 >ref|XP_006658876.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Oryza brachyantha] Length = 509 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW 232 KF++ D +++VRDRNRFHHF GLCSC DYW Sbjct: 477 KFISLAYDRKLIVRDRNRFHHFSEGLCSCNDYW 509 >ref|XP_006651864.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like, partial [Oryza brachyantha] Length = 761 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -1 Query: 330 KFVTSTIDEEIVVRDRNRFHHFHRGLCSCKDYW 232 KFV+ D EI+VRD RFHHF GLCSCKDYW Sbjct: 729 KFVSRVTDREIIVRDATRFHHFRDGLCSCKDYW 761