BLASTX nr result
ID: Mentha25_contig00014520
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00014520 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25815.1| hypothetical protein MIMGU_mgv1a013647mg [Mimulus... 82 8e-14 >gb|EYU25815.1| hypothetical protein MIMGU_mgv1a013647mg [Mimulus guttatus] Length = 214 Score = 82.0 bits (201), Expect = 8e-14 Identities = 43/63 (68%), Positives = 48/63 (76%), Gaps = 2/63 (3%) Frame = -1 Query: 185 MASISLHTTYSFPSSLHTQTPKAALSHNLPLLSKS--SQFHGLKLSNSSYFSIPSPISGK 12 MA+I+LHT + PS LHTQTPK SHNL L+SKS SQFHGLKLSNSS+ SIPS S K Sbjct: 1 MAAITLHTNRTLPSLLHTQTPKPTFSHNLSLISKSSHSQFHGLKLSNSSHLSIPSSASAK 60 Query: 11 SAI 3 S I Sbjct: 61 SCI 63